BLASTX nr result
ID: Akebia25_contig00061497
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00061497 (210 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI40339.3| unnamed protein product [Vitis vinifera] 51 1e-13 ref|XP_002271786.1| PREDICTED: putative ripening-related protein... 51 1e-13 ref|XP_002273597.1| PREDICTED: putative ripening-related protein... 51 6e-13 ref|XP_003633977.1| PREDICTED: putative ripening-related protein... 51 6e-13 emb|CAN61347.1| hypothetical protein VITISV_007855 [Vitis vinifera] 51 6e-13 emb|CBI40342.3| unnamed protein product [Vitis vinifera] 50 1e-12 ref|XP_002271952.1| PREDICTED: putative ripening-related protein... 50 1e-12 ref|XP_002265810.1| PREDICTED: putative ripening-related protein... 50 1e-12 ref|XP_002513616.1| Kiwellin, putative [Ricinus communis] gi|223... 51 3e-12 ref|XP_002529817.1| Kiwellin, putative [Ricinus communis] gi|223... 51 3e-12 ref|XP_002273508.1| PREDICTED: putative ripening-related protein... 49 3e-12 ref|XP_006339790.1| PREDICTED: putative ripening-related protein... 49 4e-12 ref|XP_002273655.1| PREDICTED: putative ripening-related protein... 56 4e-12 emb|CAN71973.1| hypothetical protein VITISV_009241 [Vitis vinifera] 50 8e-12 ref|XP_007021719.1| Ripening-related protein 1 [Theobroma cacao]... 49 8e-12 ref|XP_003623919.1| Ripening-related protein [Medicago truncatul... 49 1e-11 ref|XP_003623915.1| Ripening-related protein [Medicago truncatul... 51 2e-11 ref|XP_007051837.1| Ripening-related protein 1 [Theobroma cacao]... 52 2e-11 ref|XP_004231182.1| PREDICTED: putative ripening-related protein... 49 2e-11 ref|XP_002320124.1| hypothetical protein POPTR_0014s07770g [Popu... 51 2e-11 >emb|CBI40339.3| unnamed protein product [Vitis vinifera] Length = 192 Score = 51.2 bits (121), Expect(2) = 1e-13 Identities = 21/32 (65%), Positives = 28/32 (87%), Gaps = 1/32 (3%) Frame = +3 Query: 27 ECLNVEGQSCKPSGKVRGMKRPPGQCPE-NDS 119 +CL+V+GQ+CKPSGK+RG K PPG+C + NDS Sbjct: 20 DCLHVQGQNCKPSGKIRGKKPPPGECNDGNDS 51 Score = 50.4 bits (119), Expect(2) = 1e-13 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 119 CCVPEKFYTIYKCSPSVSSHTKAVLTINSF 208 CC KFYT YKCSP VSSHTK LT+N F Sbjct: 53 CCKEGKFYTTYKCSPQVSSHTKGFLTLNGF 82 >ref|XP_002271786.1| PREDICTED: putative ripening-related protein 2 [Vitis vinifera] Length = 188 Score = 51.2 bits (121), Expect(2) = 1e-13 Identities = 21/32 (65%), Positives = 28/32 (87%), Gaps = 1/32 (3%) Frame = +3 Query: 27 ECLNVEGQSCKPSGKVRGMKRPPGQCPE-NDS 119 +CL+V+GQ+CKPSGK+RG K PPG+C + NDS Sbjct: 20 DCLHVQGQNCKPSGKIRGKKPPPGECNDGNDS 51 Score = 50.4 bits (119), Expect(2) = 1e-13 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 119 CCVPEKFYTIYKCSPSVSSHTKAVLTINSF 208 CC KFYT YKCSP VSSHTK LT+N F Sbjct: 53 CCKEGKFYTTYKCSPQVSSHTKGFLTLNGF 82 >ref|XP_002273597.1| PREDICTED: putative ripening-related protein 2-like [Vitis vinifera] Length = 188 Score = 50.8 bits (120), Expect(2) = 6e-13 Identities = 22/32 (68%), Positives = 26/32 (81%), Gaps = 1/32 (3%) Frame = +3 Query: 27 ECLNVEGQSCKPSGKVRGMKRPPGQCPE-NDS 119 +CLNVEGQ C PSGK+RG K PPG+C + NDS Sbjct: 20 DCLNVEGQVCHPSGKIRGKKPPPGECNQGNDS 51 Score = 48.5 bits (114), Expect(2) = 6e-13 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = +2 Query: 119 CCVPEKFYTIYKCSPSVSSHTKAVLTINSF 208 CC K YT YKCSP+VSSH+KA LT+N F Sbjct: 53 CCKEGKLYTTYKCSPTVSSHSKAYLTLNGF 82 >ref|XP_003633977.1| PREDICTED: putative ripening-related protein 2-like [Vitis vinifera] gi|147820572|emb|CAN63234.1| hypothetical protein VITISV_026714 [Vitis vinifera] Length = 188 Score = 50.8 bits (120), Expect(2) = 6e-13 Identities = 22/32 (68%), Positives = 26/32 (81%), Gaps = 1/32 (3%) Frame = +3 Query: 27 ECLNVEGQSCKPSGKVRGMKRPPGQCPE-NDS 119 +CLNVEGQ C PSGK+RG K PPG+C + NDS Sbjct: 20 DCLNVEGQVCHPSGKIRGKKPPPGECNQGNDS 51 Score = 48.5 bits (114), Expect(2) = 6e-13 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = +2 Query: 119 CCVPEKFYTIYKCSPSVSSHTKAVLTINSF 208 CC K YT YKCSP+VSSH+KA LT+N F Sbjct: 53 CCKEGKLYTTYKCSPTVSSHSKAYLTLNGF 82 >emb|CAN61347.1| hypothetical protein VITISV_007855 [Vitis vinifera] Length = 187 Score = 50.8 bits (120), Expect(2) = 6e-13 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 119 CCVPEKFYTIYKCSPSVSSHTKAVLTINSF 208 CC KFYT YKCSP VSSHTK LT+N F Sbjct: 52 CCXEGKFYTTYKCSPQVSSHTKGFLTLNGF 81 Score = 48.5 bits (114), Expect(2) = 6e-13 Identities = 20/32 (62%), Positives = 27/32 (84%), Gaps = 1/32 (3%) Frame = +3 Query: 27 ECLNVEGQSCKPSGKVRGMKRPPGQCPE-NDS 119 +CL+V+GQ+CKPS K+RG K PPG+C + NDS Sbjct: 19 DCLHVQGQNCKPSXKIRGKKPPPGECNDGNDS 50 >emb|CBI40342.3| unnamed protein product [Vitis vinifera] Length = 188 Score = 50.1 bits (118), Expect(2) = 1e-12 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +2 Query: 119 CCVPEKFYTIYKCSPSVSSHTKAVLTINSF 208 CC K YT YKCSP+VSSHTKA LT+N F Sbjct: 53 CCKEGKLYTTYKCSPTVSSHTKAYLTLNGF 82 Score = 48.5 bits (114), Expect(2) = 1e-12 Identities = 21/32 (65%), Positives = 26/32 (81%), Gaps = 1/32 (3%) Frame = +3 Query: 27 ECLNVEGQSCKPSGKVRGMKRPPGQCPE-NDS 119 +CL VEGQ+C PSGK+RG K PPG+C + NDS Sbjct: 20 DCLIVEGQACHPSGKIRGKKPPPGECNQGNDS 51 >ref|XP_002271952.1| PREDICTED: putative ripening-related protein 2-like [Vitis vinifera] Length = 176 Score = 50.1 bits (118), Expect(2) = 1e-12 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +2 Query: 119 CCVPEKFYTIYKCSPSVSSHTKAVLTINSF 208 CC K YT YKCSP+VSSHTKA LT+N F Sbjct: 41 CCKEGKLYTTYKCSPTVSSHTKAYLTLNGF 70 Score = 48.5 bits (114), Expect(2) = 1e-12 Identities = 21/32 (65%), Positives = 26/32 (81%), Gaps = 1/32 (3%) Frame = +3 Query: 27 ECLNVEGQSCKPSGKVRGMKRPPGQCPE-NDS 119 +CL VEGQ+C PSGK+RG K PPG+C + NDS Sbjct: 8 DCLIVEGQACHPSGKIRGKKPPPGECNQGNDS 39 >ref|XP_002265810.1| PREDICTED: putative ripening-related protein 2 [Vitis vinifera] Length = 188 Score = 50.1 bits (118), Expect(2) = 1e-12 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +2 Query: 119 CCVPEKFYTIYKCSPSVSSHTKAVLTINSF 208 CC K YT YKCSP+VSSHTKA LT+N F Sbjct: 53 CCKEGKLYTTYKCSPTVSSHTKAYLTLNGF 82 Score = 48.1 bits (113), Expect(2) = 1e-12 Identities = 21/32 (65%), Positives = 25/32 (78%), Gaps = 1/32 (3%) Frame = +3 Query: 27 ECLNVEGQSCKPSGKVRGMKRPPGQCPE-NDS 119 +CLNV GQ C PSGK+RG K PPG+C + NDS Sbjct: 20 DCLNVGGQVCHPSGKIRGKKPPPGECNQGNDS 51 >ref|XP_002513616.1| Kiwellin, putative [Ricinus communis] gi|223547524|gb|EEF49019.1| Kiwellin, putative [Ricinus communis] Length = 187 Score = 51.2 bits (121), Expect(2) = 3e-12 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +2 Query: 119 CCVPEKFYTIYKCSPSVSSHTKAVLTINSF 208 CCV K YT YKCSP V+ HTKA LT+NSF Sbjct: 51 CCVQGKMYTTYKCSPPVTGHTKATLTVNSF 80 Score = 45.8 bits (107), Expect(2) = 3e-12 Identities = 20/29 (68%), Positives = 24/29 (82%), Gaps = 1/29 (3%) Frame = +3 Query: 36 NVEGQSCKPSGKVRGMKRPPGQC-PENDS 119 +VE Q+C+PSGK+RG K PPGQC ENDS Sbjct: 21 SVESQTCRPSGKIRGTKPPPGQCNQENDS 49 >ref|XP_002529817.1| Kiwellin, putative [Ricinus communis] gi|223530694|gb|EEF32566.1| Kiwellin, putative [Ricinus communis] Length = 187 Score = 51.2 bits (121), Expect(2) = 3e-12 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +2 Query: 119 CCVPEKFYTIYKCSPSVSSHTKAVLTINSF 208 CCV K YT YKCSP V+ HTKA LT+NSF Sbjct: 51 CCVQGKMYTTYKCSPPVTGHTKATLTVNSF 80 Score = 45.8 bits (107), Expect(2) = 3e-12 Identities = 20/29 (68%), Positives = 24/29 (82%), Gaps = 1/29 (3%) Frame = +3 Query: 36 NVEGQSCKPSGKVRGMKRPPGQC-PENDS 119 +VE Q+C+PSGK+RG K PPGQC ENDS Sbjct: 21 SVESQTCRPSGKIRGRKSPPGQCNRENDS 49 >ref|XP_002273508.1| PREDICTED: putative ripening-related protein 2-like [Vitis vinifera] Length = 176 Score = 48.9 bits (115), Expect(2) = 3e-12 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = +2 Query: 119 CCVPEKFYTIYKCSPSVSSHTKAVLTINSF 208 CC K YT YKCSP++SSHTKA LT+N F Sbjct: 41 CCKEGKLYTTYKCSPTLSSHTKAYLTLNGF 70 Score = 48.1 bits (113), Expect(2) = 3e-12 Identities = 22/33 (66%), Positives = 26/33 (78%), Gaps = 1/33 (3%) Frame = +3 Query: 24 IECLNVEGQSCKPSGKVRGMKRPPGQCPE-NDS 119 I+ LNVEGQ C PSGK+RG K PPG+C + NDS Sbjct: 7 IDFLNVEGQVCHPSGKIRGKKPPPGECNQGNDS 39 >ref|XP_006339790.1| PREDICTED: putative ripening-related protein 1-like [Solanum tuberosum] Length = 189 Score = 49.3 bits (116), Expect(2) = 4e-12 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = +2 Query: 119 CCVPEKFYTIYKCSPSVSSHTKAVLTINSF 208 CC K YT YKCSPSV+ +TKAVLT+NSF Sbjct: 54 CCKQGKMYTTYKCSPSVTGNTKAVLTLNSF 83 Score = 47.4 bits (111), Expect(2) = 4e-12 Identities = 20/31 (64%), Positives = 25/31 (80%), Gaps = 1/31 (3%) Frame = +3 Query: 30 CLNVEGQSCKPSGKVRGMKRPPGQC-PENDS 119 CL+ Q+C+PSG +RG+K PPGQC PENDS Sbjct: 22 CLDARLQACQPSGSIRGIKPPPGQCNPENDS 52 >ref|XP_002273655.1| PREDICTED: putative ripening-related protein 2-like [Vitis vinifera] Length = 188 Score = 55.8 bits (133), Expect(2) = 4e-12 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +2 Query: 119 CCVPEKFYTIYKCSPSVSSHTKAVLTINSF 208 CCV K YT YKCSP+VSSHTKAVLT+NSF Sbjct: 53 CCVQGKLYTTYKCSPAVSSHTKAVLTLNSF 82 Score = 40.8 bits (94), Expect(2) = 4e-12 Identities = 18/32 (56%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Frame = +3 Query: 27 ECLNVEGQSCKPSGKVRGMKRPPGQC-PENDS 119 E ++V Q+C+PSG +RG K PPG C ENDS Sbjct: 20 EYMDVAAQACRPSGNIRGKKPPPGGCNQENDS 51 >emb|CAN71973.1| hypothetical protein VITISV_009241 [Vitis vinifera] Length = 188 Score = 50.1 bits (118), Expect(2) = 8e-12 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +2 Query: 119 CCVPEKFYTIYKCSPSVSSHTKAVLTINSF 208 CC K YT YKCSP+VSSHTKA LT+N F Sbjct: 53 CCKEGKLYTTYKCSPTVSSHTKAYLTLNGF 82 Score = 45.4 bits (106), Expect(2) = 8e-12 Identities = 20/30 (66%), Positives = 24/30 (80%), Gaps = 1/30 (3%) Frame = +3 Query: 33 LNVEGQSCKPSGKVRGMKRPPGQCPE-NDS 119 LNV+GQ C PSGK+RG K PPG+C + NDS Sbjct: 22 LNVDGQVCHPSGKIRGKKPPPGECNQGNDS 51 >ref|XP_007021719.1| Ripening-related protein 1 [Theobroma cacao] gi|508721347|gb|EOY13244.1| Ripening-related protein 1 [Theobroma cacao] Length = 188 Score = 49.3 bits (116), Expect(2) = 8e-12 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +2 Query: 119 CCVPEKFYTIYKCSPSVSSHTKAVLTINSF 208 CC K YT Y+CSP VSSHTKA LT+NSF Sbjct: 51 CCKEGKLYTTYECSPLVSSHTKATLTLNSF 80 Score = 46.2 bits (108), Expect(2) = 8e-12 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 1/30 (3%) Frame = +3 Query: 33 LNVEGQSCKPSGKVRGMKRPPGQC-PENDS 119 + VE QSCKPSGK+RG K PPG+C ENDS Sbjct: 20 VGVEAQSCKPSGKIRGKKPPPGKCNRENDS 49 >ref|XP_003623919.1| Ripening-related protein [Medicago truncatula] gi|355498934|gb|AES80137.1| Ripening-related protein [Medicago truncatula] Length = 255 Score = 48.9 bits (115), Expect(2) = 1e-11 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +2 Query: 119 CCVPEKFYTIYKCSPSVSSHTKAVLTINSF 208 CCV K YT Y CSP VS+HTKA LT+NSF Sbjct: 54 CCVEGKMYTTYVCSPYVSTHTKAYLTLNSF 83 Score = 45.8 bits (107), Expect(2) = 1e-11 Identities = 19/34 (55%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Frame = +3 Query: 21 IIECLNVEGQSCKPSGKVRGMKRPPGQC-PENDS 119 + C+ E Q+C+PSG++RG K PPGQC ENDS Sbjct: 19 LTNCVYSEAQNCRPSGRIRGKKAPPGQCNQENDS 52 >ref|XP_003623915.1| Ripening-related protein [Medicago truncatula] gi|355498930|gb|AES80133.1| Ripening-related protein [Medicago truncatula] Length = 353 Score = 51.2 bits (121), Expect(2) = 2e-11 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = +2 Query: 119 CCVPEKFYTIYKCSPSVSSHTKAVLTINSF 208 CCV K YT Y CSPSVS+HTKA LT+NSF Sbjct: 54 CCVQGKMYTTYVCSPSVSTHTKAYLTLNSF 83 Score = 43.1 bits (100), Expect(2) = 2e-11 Identities = 18/27 (66%), Positives = 22/27 (81%), Gaps = 1/27 (3%) Frame = +3 Query: 42 EGQSCKPSGKVRGMKRPPGQC-PENDS 119 E Q+C+PSG++RG K PPGQC ENDS Sbjct: 26 EAQNCRPSGRIRGKKAPPGQCNQENDS 52 >ref|XP_007051837.1| Ripening-related protein 1 [Theobroma cacao] gi|508704098|gb|EOX95994.1| Ripening-related protein 1 [Theobroma cacao] Length = 187 Score = 51.6 bits (122), Expect(2) = 2e-11 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = +2 Query: 119 CCVPEKFYTIYKCSPSVSSHTKAVLTINSF 208 CC K+YT YKCSP VSSHTKA LT+NSF Sbjct: 51 CCKDGKWYTTYKCSPPVSSHTKATLTLNSF 80 Score = 42.7 bits (99), Expect(2) = 2e-11 Identities = 19/30 (63%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Frame = +3 Query: 33 LNVEGQSCKPSGKVRGMKRPPGQC-PENDS 119 L E Q+C PSGK+RG PPGQC ENDS Sbjct: 20 LGAEAQTCNPSGKIRGKNPPPGQCNQENDS 49 >ref|XP_004231182.1| PREDICTED: putative ripening-related protein 1-like [Solanum lycopersicum] Length = 349 Score = 48.9 bits (115), Expect(2) = 2e-11 Identities = 21/31 (67%), Positives = 25/31 (80%), Gaps = 1/31 (3%) Frame = +3 Query: 30 CLNVEGQSCKPSGKVRGMKRPPGQC-PENDS 119 CL+ Q C+PSGK+RG+K PPGQC PENDS Sbjct: 22 CLDARLQGCQPSGKIRGIKPPPGQCNPENDS 52 Score = 45.1 bits (105), Expect(2) = 2e-11 Identities = 19/30 (63%), Positives = 22/30 (73%) Frame = +2 Query: 119 CCVPEKFYTIYKCSPSVSSHTKAVLTINSF 208 CC K YT Y CSP V+ +TKAVLT+NSF Sbjct: 54 CCKQGKLYTTYTCSPPVTGNTKAVLTLNSF 83 Score = 47.4 bits (111), Expect(2) = 7e-10 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = +2 Query: 119 CCVPEKFYTIYKCSPSVSSHTKAVLTINSF 208 CC K YT YKCSP V+ +TKAVLT+NSF Sbjct: 214 CCKQGKIYTTYKCSPPVTGNTKAVLTLNSF 243 Score = 41.6 bits (96), Expect(2) = 7e-10 Identities = 17/24 (70%), Positives = 21/24 (87%), Gaps = 1/24 (4%) Frame = +3 Query: 51 SCKPSGKVRGMKRPPGQC-PENDS 119 +C+PSG +RG+K PPGQC PENDS Sbjct: 189 ACQPSGSIRGIKPPPGQCNPENDS 212 >ref|XP_002320124.1| hypothetical protein POPTR_0014s07770g [Populus trichocarpa] gi|222860897|gb|EEE98439.1| hypothetical protein POPTR_0014s07770g [Populus trichocarpa] Length = 189 Score = 51.2 bits (121), Expect(2) = 2e-11 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = +2 Query: 119 CCVPEKFYTIYKCSPSVSSHTKAVLTINSF 208 CC K+YT YKCSP V+SHTKA LT+NSF Sbjct: 53 CCKDGKYYTTYKCSPQVTSHTKAFLTLNSF 82 Score = 42.7 bits (99), Expect(2) = 2e-11 Identities = 18/30 (60%), Positives = 23/30 (76%), Gaps = 1/30 (3%) Frame = +3 Query: 33 LNVEGQSCKPSGKVRGMKRPPGQC-PENDS 119 L++E Q C+PSG++RG K PP QC ENDS Sbjct: 22 LDIEAQQCRPSGQIRGRKPPPNQCNQENDS 51