BLASTX nr result
ID: Akebia25_contig00061425
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00061425 (297 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006446062.1| hypothetical protein CICLE_v10017709mg [Citr... 62 1e-07 ref|XP_004490339.1| PREDICTED: 52 kDa repressor of the inhibitor... 57 3e-06 ref|XP_004516249.1| PREDICTED: 52 kDa repressor of the inhibitor... 57 4e-06 ref|XP_004514535.1| PREDICTED: 52 kDa repressor of the inhibitor... 57 4e-06 ref|XP_004498004.1| PREDICTED: 52 kDa repressor of the inhibitor... 57 4e-06 ref|XP_004497855.1| PREDICTED: 52 kDa repressor of the inhibitor... 57 4e-06 ref|XP_004490282.1| PREDICTED: 52 kDa repressor of the inhibitor... 57 4e-06 ref|XP_004488955.1| PREDICTED: 52 kDa repressor of the inhibitor... 57 4e-06 ref|XP_004511895.1| PREDICTED: 52 kDa repressor of the inhibitor... 56 6e-06 >ref|XP_006446062.1| hypothetical protein CICLE_v10017709mg [Citrus clementina] gi|557548673|gb|ESR59302.1| hypothetical protein CICLE_v10017709mg [Citrus clementina] Length = 228 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/49 (59%), Positives = 36/49 (73%) Frame = -2 Query: 260 FSSVCSFIWMFDVNCTVLRNIIRK*SIYSQRGDIDAAYNFITSFLFLII 114 F SVCS I MF C L++I++K S YSQRGD+D+AYN ITSF F+ I Sbjct: 31 FHSVCSLIKMFKATCEALQSIVKKGSNYSQRGDVDSAYNIITSFDFVFI 79 >ref|XP_004490339.1| PREDICTED: 52 kDa repressor of the inhibitor of the protein kinase-like, partial [Cicer arietinum] Length = 638 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/51 (47%), Positives = 36/51 (70%) Frame = -2 Query: 266 THFSSVCSFIWMFDVNCTVLRNIIRK*SIYSQRGDIDAAYNFITSFLFLII 114 +HFSS+CS I M++ C VL+ I + + YS RGD D+AYN++ +F F+ I Sbjct: 310 SHFSSICSLINMYEATCIVLKKITNERASYSTRGDADSAYNYLNAFDFIFI 360 >ref|XP_004516249.1| PREDICTED: 52 kDa repressor of the inhibitor of the protein kinase-like, partial [Cicer arietinum] Length = 812 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/51 (47%), Positives = 36/51 (70%) Frame = -2 Query: 266 THFSSVCSFIWMFDVNCTVLRNIIRK*SIYSQRGDIDAAYNFITSFLFLII 114 +HFSS+CS I M++ C VL+ I + + YS RGD D+AYN++ +F F+ I Sbjct: 484 SHFSSICSLINMYEATCIVLKKITNERASYSTRGDADSAYNYLKAFDFIFI 534 >ref|XP_004514535.1| PREDICTED: 52 kDa repressor of the inhibitor of the protein kinase-like [Cicer arietinum] Length = 905 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/51 (47%), Positives = 36/51 (70%) Frame = -2 Query: 266 THFSSVCSFIWMFDVNCTVLRNIIRK*SIYSQRGDIDAAYNFITSFLFLII 114 +HFSS+CS I M++ C VL+ I + + YS RGD D+AYN++ +F F+ I Sbjct: 577 SHFSSICSLINMYEATCIVLKKITNERASYSTRGDADSAYNYLKAFDFIFI 627 >ref|XP_004498004.1| PREDICTED: 52 kDa repressor of the inhibitor of the protein kinase-like, partial [Cicer arietinum] Length = 780 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/51 (47%), Positives = 36/51 (70%) Frame = -2 Query: 266 THFSSVCSFIWMFDVNCTVLRNIIRK*SIYSQRGDIDAAYNFITSFLFLII 114 +HFSS+CS I M++ C VL+ I + + YS RGD D+AYN++ +F F+ I Sbjct: 458 SHFSSICSLINMYEATCIVLKKITNERASYSTRGDADSAYNYLKAFDFIFI 508 >ref|XP_004497855.1| PREDICTED: 52 kDa repressor of the inhibitor of the protein kinase-like, partial [Cicer arietinum] Length = 812 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/51 (47%), Positives = 36/51 (70%) Frame = -2 Query: 266 THFSSVCSFIWMFDVNCTVLRNIIRK*SIYSQRGDIDAAYNFITSFLFLII 114 +HFSS+CS I M++ C VL+ I + + YS RGD D+AYN++ +F F+ I Sbjct: 484 SHFSSICSLINMYEATCIVLKKITNERASYSTRGDADSAYNYLKAFDFIFI 534 >ref|XP_004490282.1| PREDICTED: 52 kDa repressor of the inhibitor of the protein kinase-like, partial [Cicer arietinum] Length = 812 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/51 (47%), Positives = 36/51 (70%) Frame = -2 Query: 266 THFSSVCSFIWMFDVNCTVLRNIIRK*SIYSQRGDIDAAYNFITSFLFLII 114 +HFSS+CS I M++ C VL+ I + + YS RGD D+AYN++ +F F+ I Sbjct: 484 SHFSSICSLINMYEATCIVLKKITNERASYSTRGDADSAYNYLKAFDFIFI 534 >ref|XP_004488955.1| PREDICTED: 52 kDa repressor of the inhibitor of the protein kinase-like, partial [Cicer arietinum] Length = 812 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/51 (47%), Positives = 36/51 (70%) Frame = -2 Query: 266 THFSSVCSFIWMFDVNCTVLRNIIRK*SIYSQRGDIDAAYNFITSFLFLII 114 +HFSS+CS I M++ C VL+ I + + YS RGD D+AYN++ +F F+ I Sbjct: 484 SHFSSICSLINMYEATCIVLKKITNERASYSTRGDADSAYNYLKAFDFIFI 534 >ref|XP_004511895.1| PREDICTED: 52 kDa repressor of the inhibitor of the protein kinase-like [Cicer arietinum] Length = 455 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/51 (49%), Positives = 35/51 (68%) Frame = -2 Query: 266 THFSSVCSFIWMFDVNCTVLRNIIRK*SIYSQRGDIDAAYNFITSFLFLII 114 +HFSS+CS I M++ C VL+ I + YS RGD D+AYN++ SF F+ I Sbjct: 185 SHFSSICSLINMYEAICIVLKKITNERGNYSTRGDADSAYNYLKSFDFIFI 235