BLASTX nr result
ID: Akebia25_contig00061252
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00061252 (429 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN65484.1| hypothetical protein VITISV_029474 [Vitis vinifera] 44 1e-05 >emb|CAN65484.1| hypothetical protein VITISV_029474 [Vitis vinifera] Length = 1882 Score = 44.3 bits (103), Expect(2) = 1e-05 Identities = 20/44 (45%), Positives = 26/44 (59%), Gaps = 4/44 (9%) Frame = +1 Query: 1 VNWDFQDFLLRMIGFGYKWRKWT*KCI----FGLLFHMVTPGWV 120 V+WDF D +L M GFG +WRKW C+ F +L + GWV Sbjct: 1252 VSWDFLDHVLEMKGFGIRWRKWMRGCLSSVSFAVLVNGNAKGWV 1295 Score = 30.4 bits (67), Expect(2) = 1e-05 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +2 Query: 116 GYLKGTRGLYSGDPISSFFLFIVVVESLGGWCLE 217 G++K +RGL GDP+S FLF +V + L L+ Sbjct: 1293 GWVKASRGLRQGDPLSP-FLFTIVADVLSRMLLK 1325