BLASTX nr result
ID: Akebia25_contig00060393
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00060393 (269 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON62124.1| hypothetical protein W97_01343 [Coniosporium apol... 58 1e-06 gb|EME79231.1| hypothetical protein MYCFIDRAFT_212169 [Pseudocer... 57 4e-06 >gb|EON62124.1| hypothetical protein W97_01343 [Coniosporium apollinis CBS 100218] Length = 577 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/60 (41%), Positives = 36/60 (60%), Gaps = 1/60 (1%) Frame = +2 Query: 2 SSTENSSPPNGKA-SIKQAGSKAASVHTEANPCLLECGDECGDESSCCPPTDPKGQASST 178 S +EN +P NGK ++ + SK S+ CLL+CGD CG+ CC P + +GQAS + Sbjct: 510 SCSENGAPKNGKRKTVSKQASKTGSLRDMPEECLLDCGDACGNAKQCCAPAESEGQASES 569 >gb|EME79231.1| hypothetical protein MYCFIDRAFT_212169 [Pseudocercospora fijiensis CIRAD86] Length = 533 Score = 56.6 bits (135), Expect = 4e-06 Identities = 30/61 (49%), Positives = 35/61 (57%), Gaps = 1/61 (1%) Frame = +2 Query: 26 PNGKASIKQAGSKAASVHTEANPCLLECGDEC-GDESSCCPPTDPKGQASSTHEDHHGHS 202 P+G S KQ G T N CLL+CGD+C G SCCPP + KG S +H D H HS Sbjct: 481 PSGHGSPKQQG-------TPDNSCLLDCGDDCGGGGKSCCPPANKKGTDSHSH-DGHDHS 532 Query: 203 H 205 H Sbjct: 533 H 533