BLASTX nr result
ID: Akebia25_contig00060268
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00060268 (282 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS53784.1| IAA-alanine resistance protein 1 [Triticum urartu] 56 6e-06 >gb|EMS53784.1| IAA-alanine resistance protein 1 [Triticum urartu] Length = 722 Score = 55.8 bits (133), Expect = 6e-06 Identities = 32/76 (42%), Positives = 52/76 (68%), Gaps = 10/76 (13%) Frame = -2 Query: 236 ALEKVEG--SLGLDSISMEVWKCMGNTGLLWLTK-FNIILKTKEMSGECRKTIVELI*IF 66 AL++++G ++GLD I +EVWK +G+ ++WLTK FN+I + +M GE R++I L+ IF Sbjct: 460 ALKRMKGGKAMGLDCIPIEVWKGLGDIAIVWLTKLFNLIFRANKMPGEWRRSI--LVPIF 517 Query: 65 -------SCTDYQDIK 39 SC++Y+ IK Sbjct: 518 KNKGDVQSCSNYRGIK 533