BLASTX nr result
ID: Akebia25_contig00060255
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00060255 (252 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME45947.1| hypothetical protein DOTSEDRAFT_70076 [Dothistrom... 87 2e-15 gb|EMF14867.1| hypothetical protein SEPMUDRAFT_38442 [Sphaerulin... 86 5e-15 ref|XP_003852912.1| hypothetical protein MYCGRDRAFT_70873 [Zymos... 86 5e-15 gb|EMC98682.1| hypothetical protein BAUCODRAFT_103075 [Baudoinia... 85 9e-15 gb|EON61813.1| hypothetical protein W97_01030 [Coniosporium apol... 82 8e-14 gb|EME82669.1| hypothetical protein MYCFIDRAFT_51336 [Pseudocerc... 81 1e-13 ref|XP_007583034.1| putative antibiotic biosynthesis monooxygena... 80 4e-13 gb|ETO62897.1| hypothetical protein F444_19299 [Phytophthora par... 78 1e-12 gb|EMF14429.1| MFS general substrate transporter [Sphaerulina mu... 78 1e-12 ref|XP_002907592.1| conserved hypothetical protein [Phytophthora... 78 1e-12 ref|XP_002907591.1| conserved hypothetical protein [Phytophthora... 78 1e-12 ref|XP_002895175.1| conserved hypothetical protein [Phytophthora... 78 1e-12 gb|EKG19255.1| Antibiotic biosynthesis monooxygenase [Macrophomi... 77 2e-12 gb|EHY55260.1| hypothetical protein HMPREF1120_03405 [Exophiala ... 77 2e-12 gb|EXJ70084.1| hypothetical protein A1O5_07157 [Cladophialophora... 75 7e-12 gb|EGZ29954.1| hypothetical protein PHYSODRAFT_353705 [Phytophth... 75 9e-12 gb|ETI24413.1| hypothetical protein G647_03782 [Cladophialophora... 74 2e-11 gb|EXJ60732.1| hypothetical protein A1O7_04885 [Cladophialophora... 74 3e-11 gb|EXJ91536.1| hypothetical protein A1O3_00084 [Capronia epimyce... 73 4e-11 gb|ETS77539.1| hypothetical protein PFICI_11413 [Pestalotiopsis ... 72 6e-11 >gb|EME45947.1| hypothetical protein DOTSEDRAFT_70076 [Dothistroma septosporum NZE10] Length = 124 Score = 87.4 bits (215), Expect = 2e-15 Identities = 40/55 (72%), Positives = 44/55 (80%) Frame = -3 Query: 250 QKYHLEDPYWKTFDPYVKPLLAKEMDLRRYNELDTSTPVFVENDSDLWERVKKHQ 86 QKYHLE+PYW+TFD YV PLL +EMDLRR NELDT V VE D LWERV+KHQ Sbjct: 68 QKYHLENPYWQTFDKYVIPLLDREMDLRRLNELDTREVVRVEEDEGLWERVRKHQ 122 >gb|EMF14867.1| hypothetical protein SEPMUDRAFT_38442 [Sphaerulina musiva SO2202] Length = 130 Score = 85.9 bits (211), Expect = 5e-15 Identities = 38/55 (69%), Positives = 45/55 (81%) Frame = -3 Query: 250 QKYHLEDPYWKTFDPYVKPLLAKEMDLRRYNELDTSTPVFVENDSDLWERVKKHQ 86 QKYHLE+PYW+TFDPYVKPLLA+EMDLRRYNELD S V V + LW V+++Q Sbjct: 71 QKYHLENPYWQTFDPYVKPLLAEEMDLRRYNELDLSQEVKVVQNETLWNEVEEYQ 125 >ref|XP_003852912.1| hypothetical protein MYCGRDRAFT_70873 [Zymoseptoria tritici IPO323] gi|339472794|gb|EGP87888.1| hypothetical protein MYCGRDRAFT_70873 [Zymoseptoria tritici IPO323] Length = 121 Score = 85.9 bits (211), Expect = 5e-15 Identities = 39/55 (70%), Positives = 43/55 (78%) Frame = -3 Query: 250 QKYHLEDPYWKTFDPYVKPLLAKEMDLRRYNELDTSTPVFVENDSDLWERVKKHQ 86 QKYHLE+PYW+TFD YV PLL +EMDLRR NELDTS V VE D +W VKKHQ Sbjct: 65 QKYHLENPYWQTFDKYVIPLLDREMDLRRLNELDTSEEVKVETDESMWASVKKHQ 119 >gb|EMC98682.1| hypothetical protein BAUCODRAFT_103075 [Baudoinia compniacensis UAMH 10762] Length = 122 Score = 85.1 bits (209), Expect = 9e-15 Identities = 38/57 (66%), Positives = 45/57 (78%) Frame = -3 Query: 250 QKYHLEDPYWKTFDPYVKPLLAKEMDLRRYNELDTSTPVFVENDSDLWERVKKHQAQ 80 QKYHLE+PYW+TFD YV PLL K MDLRRY+E+D+ V VE D LWE VKK+Q+Q Sbjct: 66 QKYHLENPYWQTFDKYVTPLLDKPMDLRRYHEIDSKDEVRVETDPALWEHVKKYQSQ 122 >gb|EON61813.1| hypothetical protein W97_01030 [Coniosporium apollinis CBS 100218] Length = 125 Score = 82.0 bits (201), Expect = 8e-14 Identities = 38/55 (69%), Positives = 45/55 (81%) Frame = -3 Query: 250 QKYHLEDPYWKTFDPYVKPLLAKEMDLRRYNELDTSTPVFVENDSDLWERVKKHQ 86 QKYHLE+PYWKTFDPYVKPLL +MDLRRY+E+DTS V VE++ L E VK +Q Sbjct: 65 QKYHLENPYWKTFDPYVKPLLDGDMDLRRYHEIDTSEKVTVEDEKFLEETVKGYQ 119 >gb|EME82669.1| hypothetical protein MYCFIDRAFT_51336 [Pseudocercospora fijiensis CIRAD86] Length = 124 Score = 81.3 bits (199), Expect = 1e-13 Identities = 40/57 (70%), Positives = 46/57 (80%), Gaps = 2/57 (3%) Frame = -3 Query: 250 QKYHLEDPYWKTFDPYVKPLLAKEMDLRRYNEL-DTSTP-VFVENDSDLWERVKKHQ 86 Q+YHLE+PYWKTFDPYV PLL + MDLRR NEL D STP V VE D LWERV+++Q Sbjct: 65 QRYHLENPYWKTFDPYVVPLLDRPMDLRRLNELNDESTPEVKVEKDEGLWERVREYQ 121 >ref|XP_007583034.1| putative antibiotic biosynthesis monooxygenase protein [Neofusicoccum parvum UCRNP2] gi|485924757|gb|EOD49490.1| putative antibiotic biosynthesis monooxygenase protein [Neofusicoccum parvum UCRNP2] Length = 106 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -3 Query: 250 QKYHLEDPYWKTFDPYVKPLLAKEMDLRRYNELDTSTPVFVE 125 QKYHLE+PYWKTFDPYV PLL KEMDLRR+NELDTS PV VE Sbjct: 65 QKYHLENPYWKTFDPYVIPLLEKEMDLRRFNELDTSKPVKVE 106 >gb|ETO62897.1| hypothetical protein F444_19299 [Phytophthora parasitica P1976] Length = 106 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -3 Query: 250 QKYHLEDPYWKTFDPYVKPLLAKEMDLRRYNELDTSTPVFVE 125 QKYHLE+PYWKTFDPYV PLL K MDLRR+NELDTS PV VE Sbjct: 65 QKYHLENPYWKTFDPYVIPLLDKPMDLRRFNELDTSKPVHVE 106 >gb|EMF14429.1| MFS general substrate transporter [Sphaerulina musiva SO2202] Length = 651 Score = 77.8 bits (190), Expect = 1e-12 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = -3 Query: 229 PYWKTFDPYVKPLLAKEMDLRRYNELDTSTPVFVENDSDLWERVKKHQ 86 PYW+TFDPYVKPLL +EMDLRR+NELDTS V V D +W++VK+HQ Sbjct: 602 PYWQTFDPYVKPLLDREMDLRRFNELDTSKEVRVVTDESVWDKVKEHQ 649 >ref|XP_002907592.1| conserved hypothetical protein [Phytophthora infestans T30-4] gi|262106104|gb|EEY64156.1| conserved hypothetical protein [Phytophthora infestans T30-4] Length = 106 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -3 Query: 250 QKYHLEDPYWKTFDPYVKPLLAKEMDLRRYNELDTSTPVFVE 125 QKYHLE+PYWKTFDPYV PLL K MDLRR+NELDTS PV VE Sbjct: 65 QKYHLENPYWKTFDPYVIPLLDKPMDLRRFNELDTSKPVHVE 106 >ref|XP_002907591.1| conserved hypothetical protein [Phytophthora infestans T30-4] gi|262106103|gb|EEY64155.1| conserved hypothetical protein [Phytophthora infestans T30-4] Length = 63 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -3 Query: 250 QKYHLEDPYWKTFDPYVKPLLAKEMDLRRYNELDTSTPVFVE 125 QKYHLE+PYWKTFDPYV PLL K MDLRR+NELDTS PV VE Sbjct: 22 QKYHLENPYWKTFDPYVIPLLDKPMDLRRFNELDTSKPVHVE 63 >ref|XP_002895175.1| conserved hypothetical protein [Phytophthora infestans T30-4] gi|262101448|gb|EEY59500.1| conserved hypothetical protein [Phytophthora infestans T30-4] gi|566011153|gb|ETI34064.1| hypothetical protein F443_19355 [Phytophthora parasitica P1569] gi|566011181|gb|ETI34092.1| hypothetical protein F443_19351 [Phytophthora parasitica P1569] gi|568006863|gb|ETL81111.1| hypothetical protein L917_18499 [Phytophthora parasitica] gi|568036698|gb|ETM34300.1| hypothetical protein L914_18592 [Phytophthora parasitica] gi|568103036|gb|ETN17707.1| hypothetical protein PPTG_05444 [Phytophthora parasitica INRA-310] gi|568103040|gb|ETN17711.1| hypothetical protein PPTG_05446 [Phytophthora parasitica INRA-310] gi|570314919|gb|ETO62867.1| hypothetical protein F444_19304 [Phytophthora parasitica P1976] gi|570938705|gb|ETP03962.1| hypothetical protein F441_19174 [Phytophthora parasitica CJ01A1] gi|570947781|gb|ETP13038.1| hypothetical protein F441_11690 [Phytophthora parasitica CJ01A1] gi|570968983|gb|ETP32102.1| hypothetical protein F442_19126 [Phytophthora parasitica P10297] gi|570968998|gb|ETP32117.1| hypothetical protein F442_19124 [Phytophthora parasitica P10297] Length = 106 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -3 Query: 250 QKYHLEDPYWKTFDPYVKPLLAKEMDLRRYNELDTSTPVFVE 125 QKYHLE+PYWKTFDPYV PLL K MDLRR+NELDTS PV VE Sbjct: 65 QKYHLENPYWKTFDPYVIPLLDKPMDLRRFNELDTSKPVHVE 106 >gb|EKG19255.1| Antibiotic biosynthesis monooxygenase [Macrophomina phaseolina MS6] Length = 106 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -3 Query: 250 QKYHLEDPYWKTFDPYVKPLLAKEMDLRRYNELDTSTPVFVE 125 QKYHLE+PYWKTFDPYV PLL KEMDLRR++ELDTS PV VE Sbjct: 65 QKYHLENPYWKTFDPYVIPLLDKEMDLRRFHELDTSKPVKVE 106 >gb|EHY55260.1| hypothetical protein HMPREF1120_03405 [Exophiala dermatitidis NIH/UT8656] Length = 107 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/42 (83%), Positives = 36/42 (85%) Frame = -3 Query: 250 QKYHLEDPYWKTFDPYVKPLLAKEMDLRRYNELDTSTPVFVE 125 QKYHLE+PYWKTFDPYVKPLL EMDLRRY ELDTS V VE Sbjct: 66 QKYHLENPYWKTFDPYVKPLLEGEMDLRRYEELDTSQDVVVE 107 >gb|EXJ70084.1| hypothetical protein A1O5_07157 [Cladophialophora psammophila CBS 110553] Length = 107 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = -3 Query: 250 QKYHLEDPYWKTFDPYVKPLLAKEMDLRRYNELDTSTPVFVE 125 QKYHLE+PYWKTFDPYVKPLL EMDLRR+ ELDTS V VE Sbjct: 66 QKYHLENPYWKTFDPYVKPLLEGEMDLRRFEELDTSKDVVVE 107 >gb|EGZ29954.1| hypothetical protein PHYSODRAFT_353705 [Phytophthora sojae] gi|348690141|gb|EGZ29955.1| hypothetical protein PHYSODRAFT_284543 [Phytophthora sojae] Length = 106 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = -3 Query: 250 QKYHLEDPYWKTFDPYVKPLLAKEMDLRRYNELDTSTPVFVE 125 QKYHL +PYWKTFDPYV PLL K MDLRR+NELDTS PV VE Sbjct: 65 QKYHLGNPYWKTFDPYVIPLLDKPMDLRRFNELDTSKPVHVE 106 >gb|ETI24413.1| hypothetical protein G647_03782 [Cladophialophora carrionii CBS 160.54] Length = 107 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = -3 Query: 250 QKYHLEDPYWKTFDPYVKPLLAKEMDLRRYNELDTSTPVFVE 125 QKYHLE+PYWKTFDPYVKPLL EMDLRR+ ELDT+ V VE Sbjct: 66 QKYHLENPYWKTFDPYVKPLLEGEMDLRRFEELDTTQNVVVE 107 >gb|EXJ60732.1| hypothetical protein A1O7_04885 [Cladophialophora yegresii CBS 114405] Length = 107 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = -3 Query: 250 QKYHLEDPYWKTFDPYVKPLLAKEMDLRRYNELDTSTPVFVE 125 QKYHLE+PYWKTFDPYVKPLL EM+LRR+ ELDTS V VE Sbjct: 66 QKYHLENPYWKTFDPYVKPLLEGEMNLRRFEELDTSKDVVVE 107 >gb|EXJ91536.1| hypothetical protein A1O3_00084 [Capronia epimyces CBS 606.96] Length = 107 Score = 73.2 bits (178), Expect = 4e-11 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -3 Query: 250 QKYHLEDPYWKTFDPYVKPLLAKEMDLRRYNELDTSTPVFV 128 QKYHLE+PYWKTFDPYVKPLL EMDLRR+ ELDTS V + Sbjct: 66 QKYHLENPYWKTFDPYVKPLLEGEMDLRRFEELDTSKDVVI 106 >gb|ETS77539.1| hypothetical protein PFICI_11413 [Pestalotiopsis fici W106-1] Length = 107 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -3 Query: 250 QKYHLEDPYWKTFDPYVKPLLAKEMDLRRYNELDTSTPVFV 128 QKYHLE+PYWKTFDPYV PLLAK MDLRR+ ELDTS V V Sbjct: 65 QKYHLENPYWKTFDPYVIPLLAKPMDLRRHEELDTSKDVVV 105