BLASTX nr result
ID: Akebia25_contig00060197
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00060197 (266 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME84190.1| hypothetical protein MYCFIDRAFT_214645 [Pseudocer... 58 1e-06 gb|EMC98838.1| hypothetical protein BAUCODRAFT_31100 [Baudoinia ... 57 2e-06 >gb|EME84190.1| hypothetical protein MYCFIDRAFT_214645 [Pseudocercospora fijiensis CIRAD86] Length = 400 Score = 58.2 bits (139), Expect = 1e-06 Identities = 35/77 (45%), Positives = 50/77 (64%), Gaps = 1/77 (1%) Frame = +1 Query: 37 RRKSRREEEATNEKGGRSPKRNISVLSRSGLLGRGHHAQQDSNNEKDFDEPIH-PGSSSQ 213 RRK R++ E + ++ RN+SVLS++GLL R + + S E+D D+ I+ G +S Sbjct: 255 RRKRRQDGEESGNGNAKNLGRNVSVLSKAGLLARNN--TRPSMGERDHDDNIYQTGQNSV 312 Query: 214 RHSMLFGAAATAEGVSP 264 RHSM+FG A AEGVSP Sbjct: 313 RHSMMFGPGA-AEGVSP 328 >gb|EMC98838.1| hypothetical protein BAUCODRAFT_31100 [Baudoinia compniacensis UAMH 10762] Length = 488 Score = 57.4 bits (137), Expect = 2e-06 Identities = 37/85 (43%), Positives = 50/85 (58%), Gaps = 8/85 (9%) Frame = +1 Query: 34 RRRKSRREEE-----ATNEKGGRSPKRNISVLSRSGLLGRGHHAQQDSNNEKDFDEPIH- 195 RRR+ ++ A G SP+RN+SVLS++GLL RG + S EK+FD PI+ Sbjct: 336 RRRQGDNDDAEGAGAAQKRSGPNSPRRNVSVLSKTGLLSRG---RAPSITEKEFDPPIYG 392 Query: 196 PGSSSQRHSMLFGAAAT--AEGVSP 264 G +S RHS F +AA A+ VSP Sbjct: 393 TGHNSMRHSTFFASAAASEAQAVSP 417