BLASTX nr result
ID: Akebia25_contig00060165
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00060165 (256 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002479751.1| conserved hypothetical protein [Talaromyces ... 63 5e-08 ref|XP_664192.1| hypothetical protein AN6588.2 [Aspergillus nidu... 63 5e-08 dbj|GAD91509.1| conserved hypothetical protein [Byssochlamys spe... 62 8e-08 gb|EFW19096.1| conserved hypothetical protein [Coccidioides posa... 62 1e-07 ref|XP_001396660.2| hypothetical protein ANI_1_202134 [Aspergill... 62 1e-07 emb|CAL00934.1| unnamed protein product [Aspergillus niger] 62 1e-07 ref|XP_001239195.1| hypothetical protein CIMG_10217 [Coccidioide... 62 1e-07 dbj|GAA86320.1| similar to An15g01200 [Aspergillus kawachii IFO ... 61 1e-07 ref|XP_002543990.1| conserved hypothetical protein [Uncinocarpus... 61 1e-07 ref|XP_001209708.1| conserved hypothetical protein [Aspergillus ... 61 1e-07 ref|XP_001270123.1| conserved hypothetical protein [Aspergillus ... 61 2e-07 ref|XP_747648.1| conserved hypothetical protein [Aspergillus fum... 60 4e-07 ref|XP_002378321.1| conserved hypothetical protein [Aspergillus ... 60 4e-07 ref|XP_001257635.1| hypothetical protein NFIA_050830 [Neosartory... 60 4e-07 gb|EYE96676.1| hypothetical protein EURHEDRAFT_410459 [Aspergill... 59 9e-07 ref|XP_002143432.1| conserved hypothetical protein [Talaromyces ... 58 1e-06 gb|EHY56761.1| hypothetical protein HMPREF1120_04828 [Exophiala ... 55 8e-06 gb|EHA24497.1| hypothetical protein ASPNIDRAFT_137591 [Aspergill... 55 1e-05 >ref|XP_002479751.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] gi|218719898|gb|EED19317.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] Length = 165 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +1 Query: 1 MEPYSEKLPPYQENESDRFQSLDLDRMGGLKEEEQEARWS 120 + P ++LPPYQ NES RFQSLDL+RMGGLKE+E+ RWS Sbjct: 126 LSPAQDELPPYQTNESGRFQSLDLERMGGLKEKEETKRWS 165 >ref|XP_664192.1| hypothetical protein AN6588.2 [Aspergillus nidulans FGSC A4] gi|40738927|gb|EAA58117.1| hypothetical protein AN6588.2 [Aspergillus nidulans FGSC A4] gi|259480165|tpe|CBF71047.1| TPA: hypothetical protein ANIA_06588 [Aspergillus nidulans FGSC A4] Length = 181 Score = 62.8 bits (151), Expect = 5e-08 Identities = 24/39 (61%), Positives = 34/39 (87%) Frame = +1 Query: 1 MEPYSEKLPPYQENESDRFQSLDLDRMGGLKEEEQEARW 117 +EPY+++LPPYQ ++DRFQSLD++RMGGLKE++ RW Sbjct: 142 LEPYNDQLPPYQSTDADRFQSLDIERMGGLKEKDDTKRW 180 >dbj|GAD91509.1| conserved hypothetical protein [Byssochlamys spectabilis No. 5] Length = 179 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +1 Query: 1 MEPYSEKLPPYQENESDRFQSLDLDRMGGLKEEEQEARWS 120 +EP E LPPYQ N+++RFQSLDL+RMGGLKE++ RWS Sbjct: 140 LEPCHEDLPPYQSNDAERFQSLDLERMGGLKEKQDAKRWS 179 >gb|EFW19096.1| conserved hypothetical protein [Coccidioides posadasii str. Silveira] Length = 186 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +1 Query: 1 MEPYSEKLPPYQENESDRFQSLDLDRMGGLKEEEQEARWS 120 +EPY+E LPPYQ N SDRFQSLDLDRMGGLK++ ++S Sbjct: 147 LEPYTESLPPYQANSSDRFQSLDLDRMGGLKDKCDSKQYS 186 >ref|XP_001396660.2| hypothetical protein ANI_1_202134 [Aspergillus niger CBS 513.88] Length = 182 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/40 (62%), Positives = 35/40 (87%) Frame = +1 Query: 1 MEPYSEKLPPYQENESDRFQSLDLDRMGGLKEEEQEARWS 120 +EP +E+LPPYQ ++++RFQSLD++RMGGLKE+E RWS Sbjct: 143 LEPCNEELPPYQSSDAERFQSLDIERMGGLKEKESTNRWS 182 >emb|CAL00934.1| unnamed protein product [Aspergillus niger] Length = 159 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/40 (62%), Positives = 35/40 (87%) Frame = +1 Query: 1 MEPYSEKLPPYQENESDRFQSLDLDRMGGLKEEEQEARWS 120 +EP +E+LPPYQ ++++RFQSLD++RMGGLKE+E RWS Sbjct: 120 LEPCNEELPPYQSSDAERFQSLDIERMGGLKEKESTNRWS 159 >ref|XP_001239195.1| hypothetical protein CIMG_10217 [Coccidioides immitis RS] gi|392869406|gb|EJB11751.1| hypothetical protein CIMG_10217 [Coccidioides immitis RS] Length = 187 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +1 Query: 1 MEPYSEKLPPYQENESDRFQSLDLDRMGGLKEEEQEARWS 120 +EPY+E LPPYQ N SDRFQSLDLDRMGGLK++ ++S Sbjct: 148 LEPYTESLPPYQANSSDRFQSLDLDRMGGLKDKCDSKQYS 187 >dbj|GAA86320.1| similar to An15g01200 [Aspergillus kawachii IFO 4308] Length = 182 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/40 (62%), Positives = 35/40 (87%) Frame = +1 Query: 1 MEPYSEKLPPYQENESDRFQSLDLDRMGGLKEEEQEARWS 120 +EP +E+LPPYQ ++++RFQSLD++RMGGLKE+E RWS Sbjct: 143 LEPCNEELPPYQSSDAERFQSLDIERMGGLKEKEATNRWS 182 >ref|XP_002543990.1| conserved hypothetical protein [Uncinocarpus reesii 1704] gi|237904260|gb|EEP78661.1| conserved hypothetical protein [Uncinocarpus reesii 1704] Length = 181 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = +1 Query: 1 MEPYSEKLPPYQENESDRFQSLDLDRMGGLKEEEQEARWS 120 +EPYSE LPPYQ N +DRFQSLDL+R+GGLK+++ R+S Sbjct: 142 LEPYSESLPPYQANTADRFQSLDLERIGGLKDKDDMKRYS 181 >ref|XP_001209708.1| conserved hypothetical protein [Aspergillus terreus NIH2624] gi|114190706|gb|EAU32406.1| conserved hypothetical protein [Aspergillus terreus NIH2624] Length = 159 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/40 (62%), Positives = 35/40 (87%) Frame = +1 Query: 1 MEPYSEKLPPYQENESDRFQSLDLDRMGGLKEEEQEARWS 120 +EP +E+LPPYQ ++++RFQSLD++RMGGLKE+E RWS Sbjct: 120 LEPCNEELPPYQSSDAERFQSLDIERMGGLKEKEDIKRWS 159 >ref|XP_001270123.1| conserved hypothetical protein [Aspergillus clavatus NRRL 1] gi|119398267|gb|EAW08697.1| conserved hypothetical protein [Aspergillus clavatus NRRL 1] Length = 192 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/40 (62%), Positives = 34/40 (85%) Frame = +1 Query: 1 MEPYSEKLPPYQENESDRFQSLDLDRMGGLKEEEQEARWS 120 +EP E+LPPYQ ++++RFQSLD++RMGGLKE+E RWS Sbjct: 153 LEPCHEELPPYQSSDAERFQSLDIERMGGLKEKEDMKRWS 192 >ref|XP_747648.1| conserved hypothetical protein [Aspergillus fumigatus Af293] gi|66845275|gb|EAL85610.1| conserved hypothetical protein [Aspergillus fumigatus Af293] gi|159122434|gb|EDP47555.1| conserved hypothetical protein [Aspergillus fumigatus A1163] Length = 182 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/40 (60%), Positives = 35/40 (87%) Frame = +1 Query: 1 MEPYSEKLPPYQENESDRFQSLDLDRMGGLKEEEQEARWS 120 +EP +E+LPPYQ ++++RFQSLD++RMGGLKE++ RWS Sbjct: 143 LEPCNEELPPYQTSDAERFQSLDIERMGGLKEKDDLKRWS 182 >ref|XP_002378321.1| conserved hypothetical protein [Aspergillus flavus NRRL3357] gi|317148912|ref|XP_001823003.2| hypothetical protein AOR_1_218114 [Aspergillus oryzae RIB40] gi|220694971|gb|EED51314.1| conserved hypothetical protein [Aspergillus flavus NRRL3357] gi|391872439|gb|EIT81566.1| hypothetical protein Ao3042_01985 [Aspergillus oryzae 3.042] Length = 183 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/40 (60%), Positives = 34/40 (85%) Frame = +1 Query: 1 MEPYSEKLPPYQENESDRFQSLDLDRMGGLKEEEQEARWS 120 +EP ++LPPYQ ++++RFQSLD++RMGGLKE+E RWS Sbjct: 144 LEPCHDELPPYQSSDAERFQSLDIERMGGLKEKEDVKRWS 183 >ref|XP_001257635.1| hypothetical protein NFIA_050830 [Neosartorya fischeri NRRL 181] gi|119405787|gb|EAW15738.1| conserved hypothetical protein [Neosartorya fischeri NRRL 181] Length = 182 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/40 (60%), Positives = 35/40 (87%) Frame = +1 Query: 1 MEPYSEKLPPYQENESDRFQSLDLDRMGGLKEEEQEARWS 120 +EP +E+LPPYQ ++++RFQSLD++RMGGLKE++ RWS Sbjct: 143 LEPCNEELPPYQTSDAERFQSLDIERMGGLKEKDDLKRWS 182 >gb|EYE96676.1| hypothetical protein EURHEDRAFT_410459 [Aspergillus ruber CBS 135680] Length = 178 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/40 (60%), Positives = 33/40 (82%) Frame = +1 Query: 1 MEPYSEKLPPYQENESDRFQSLDLDRMGGLKEEEQEARWS 120 +EP E+LPPYQ +++DRF SLD++RMGGLKE++ RWS Sbjct: 139 LEPCHEELPPYQSSDADRFHSLDIERMGGLKEKDDLNRWS 178 >ref|XP_002143432.1| conserved hypothetical protein [Talaromyces marneffei ATCC 18224] gi|210072830|gb|EEA26917.1| conserved hypothetical protein [Talaromyces marneffei ATCC 18224] Length = 174 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +1 Query: 1 MEPYSEKLPPYQENESDRFQSLDLDRMGGLKEEEQEARWS 120 + P ++LPPYQ NES RFQSLDL+RMGGLKE+E+ RWS Sbjct: 137 LSPAHDELPPYQTNESGRFQSLDLERMGGLKEKEE--RWS 174 >gb|EHY56761.1| hypothetical protein HMPREF1120_04828 [Exophiala dermatitidis NIH/UT8656] Length = 162 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/42 (66%), Positives = 34/42 (80%), Gaps = 2/42 (4%) Frame = +1 Query: 1 MEP-YSEKLPPYQENESDRFQSLDLDRMGGLKEEEQ-EARWS 120 MEP + E LPPYQ+ ++DRFQSLDLDR+GGLKE+E RWS Sbjct: 121 MEPLHREPLPPYQKEDADRFQSLDLDRIGGLKEKEPLGQRWS 162 >gb|EHA24497.1| hypothetical protein ASPNIDRAFT_137591 [Aspergillus niger ATCC 1015] Length = 167 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/34 (64%), Positives = 32/34 (94%) Frame = +1 Query: 1 MEPYSEKLPPYQENESDRFQSLDLDRMGGLKEEE 102 +EP +E+LPPYQ ++++RFQSLD++RMGGLKE+E Sbjct: 131 LEPCNEELPPYQSSDAERFQSLDIERMGGLKEKE 164