BLASTX nr result
ID: Akebia25_contig00060113
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00060113 (203 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006348495.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 ref|XP_004228900.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_004288922.1| PREDICTED: putative pentatricopeptide repeat... 59 5e-07 ref|XP_007203355.1| hypothetical protein PRUPE_ppa020478mg [Prun... 59 9e-07 ref|XP_006843375.1| hypothetical protein AMTR_s00053p00090700 [A... 56 6e-06 >ref|XP_006348495.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like isoform X1 [Solanum tuberosum] gi|565363546|ref|XP_006348496.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like isoform X2 [Solanum tuberosum] gi|565363548|ref|XP_006348497.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like isoform X3 [Solanum tuberosum] gi|565363550|ref|XP_006348498.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like isoform X4 [Solanum tuberosum] gi|565363552|ref|XP_006348499.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like isoform X5 [Solanum tuberosum] Length = 990 Score = 64.7 bits (156), Expect = 1e-08 Identities = 36/64 (56%), Positives = 47/64 (73%) Frame = -1 Query: 203 GEEVLKLFNKMTESEMRLSNSTLLSVLNGCSSCSRSMKRESQAIHSLVVKIGSELDGFLI 24 GEE LKLF KM++SEMR SN TL ++L GC++ S ++K Q IHS++VKIGSE+D F Sbjct: 296 GEEALKLFMKMSDSEMRFSNYTLSTILKGCAN-SVNLK-AGQVIHSMLVKIGSEIDDFTS 353 Query: 23 VVLL 12 LL Sbjct: 354 CSLL 357 >ref|XP_004228900.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680-like [Solanum lycopersicum] Length = 828 Score = 64.3 bits (155), Expect = 2e-08 Identities = 36/64 (56%), Positives = 47/64 (73%) Frame = -1 Query: 203 GEEVLKLFNKMTESEMRLSNSTLLSVLNGCSSCSRSMKRESQAIHSLVVKIGSELDGFLI 24 GEE LKLF KM++SEMR SN TL ++L GC++ S ++K Q IHS++VKIGSE+D F Sbjct: 371 GEEALKLFLKMSDSEMRFSNYTLSTILKGCAN-SVNLK-AGQVIHSMLVKIGSEIDDFTS 428 Query: 23 VVLL 12 LL Sbjct: 429 CSLL 432 >ref|XP_004288922.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950-like [Fragaria vesca subsp. vesca] Length = 984 Score = 59.3 bits (142), Expect = 5e-07 Identities = 31/59 (52%), Positives = 41/59 (69%) Frame = -1 Query: 203 GEEVLKLFNKMTESEMRLSNSTLLSVLNGCSSCSRSMKRESQAIHSLVVKIGSELDGFL 27 G +VLKLF KMTE +MRL+ TL +VL GC++ R + +HSLVVK+G E+D FL Sbjct: 295 GNQVLKLFCKMTELDMRLNKFTLSTVLKGCANVEN--LRAGRVVHSLVVKVGFEVDEFL 351 >ref|XP_007203355.1| hypothetical protein PRUPE_ppa020478mg [Prunus persica] gi|462398886|gb|EMJ04554.1| hypothetical protein PRUPE_ppa020478mg [Prunus persica] Length = 872 Score = 58.5 bits (140), Expect = 9e-07 Identities = 31/59 (52%), Positives = 41/59 (69%) Frame = -1 Query: 203 GEEVLKLFNKMTESEMRLSNSTLLSVLNGCSSCSRSMKRESQAIHSLVVKIGSELDGFL 27 G++VLKLF +MTESEMRLS TL +VL GC++ R Q +HSL +K G ++D FL Sbjct: 178 GKQVLKLFCRMTESEMRLSKFTLSTVLKGCANSEN--LRGGQFLHSLAIKSGCKIDEFL 234 >ref|XP_006843375.1| hypothetical protein AMTR_s00053p00090700 [Amborella trichopoda] gi|548845742|gb|ERN05050.1| hypothetical protein AMTR_s00053p00090700 [Amborella trichopoda] Length = 522 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/57 (50%), Positives = 38/57 (66%) Frame = -1 Query: 200 EEVLKLFNKMTESEMRLSNSTLLSVLNGCSSCSRSMKRESQAIHSLVVKIGSELDGF 30 EE L LFN+M E MR SN TL ++L GCS R+ +AIH++++KIG ELD F Sbjct: 229 EEALSLFNQMIEKGMRFSNFTLANMLKGCSIL--GSLRDGRAIHAVMIKIGCELDRF 283