BLASTX nr result
ID: Akebia25_contig00059983
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00059983 (409 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_008992354.1| hypothetical protein Salmi_Mp138 (mitochondr... 94 6e-31 ref|XP_006401947.1| hypothetical protein EUTSA_v10015949mg, part... 86 2e-21 gb|AGC78957.1| hypothetical protein (mitochondrion) [Vicia faba] 80 2e-13 gb|EMS53418.1| hypothetical protein TRIUR3_10557 [Triticum urartu] 80 4e-13 ref|XP_003588264.1| hypothetical protein MTR_1g005050 [Medicago ... 54 1e-10 gb|EXB37612.1| hypothetical protein L484_021818 [Morus notabilis] 62 8e-08 >ref|YP_008992354.1| hypothetical protein Salmi_Mp138 (mitochondrion) [Salvia miltiorrhiza] gi|534292380|gb|AGU16672.1| hypothetical protein Salmi_Mp138 (mitochondrion) [Salvia miltiorrhiza] Length = 111 Score = 94.0 bits (232), Expect(2) = 6e-31 Identities = 42/58 (72%), Positives = 47/58 (81%), Gaps = 1/58 (1%) Frame = +2 Query: 92 DQPSAPTTWYDGHSKTWQMMAHPTQKRLCHMGTHGWKQSLWF*YPVG-IIRIQVQVGW 262 DQPSAPTTWYDGHSKTW+MMAH TQ+RLC+ GTHGWKQ LWF G + +VQVGW Sbjct: 54 DQPSAPTTWYDGHSKTWRMMAHSTQERLCYRGTHGWKQPLWFVLISGRNNKKKVQVGW 111 Score = 66.2 bits (160), Expect(2) = 6e-31 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 3 RTYHARPDVEPLRAGRPGRAQVPDPKSRVS 92 RTYHARPDVEPLRAGRPGRAQVPDPKSRVS Sbjct: 24 RTYHARPDVEPLRAGRPGRAQVPDPKSRVS 53 >ref|XP_006401947.1| hypothetical protein EUTSA_v10015949mg, partial [Eutrema salsugineum] gi|557103037|gb|ESQ43400.1| hypothetical protein EUTSA_v10015949mg, partial [Eutrema salsugineum] Length = 251 Score = 85.9 bits (211), Expect(2) = 2e-21 Identities = 46/68 (67%), Positives = 48/68 (70%) Frame = +1 Query: 109 NHVVRRALKDLANDGPPHPKALMSYGNSWLETILMVLISGRNNKNPSPGWLVSLVIGDYL 288 NH +R DG +P ALMSY NSWLETILMVLISGRNNKN SPG LVSLVIGDYL Sbjct: 153 NHQIRDWAPSQRFDGMAYPIALMSYENSWLETILMVLISGRNNKNQSPGRLVSLVIGDYL 212 Query: 289 AWFGEHLL 312 A LL Sbjct: 213 ACLNAELL 220 Score = 42.0 bits (97), Expect(2) = 2e-21 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +2 Query: 347 LNAELLTLLVRMGVHPKVFLD 409 LNAELLTLLVRMGVHPKVF D Sbjct: 215 LNAELLTLLVRMGVHPKVFPD 235 >gb|AGC78957.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 106 Score = 80.5 bits (197), Expect = 2e-13 Identities = 38/54 (70%), Positives = 44/54 (81%), Gaps = 1/54 (1%) Frame = +1 Query: 157 PHPKALMSYG-NSWLETILMVLISGRNNKNPSPGWLVSLVIGDYLAWFGEHLLG 315 P + L + G + W ++ LMVLISGRNN+N SPGWLVSLVIGDYLAWFGEHLLG Sbjct: 53 PTQERLCNMGTHGWKQSFLMVLISGRNNQNKSPGWLVSLVIGDYLAWFGEHLLG 106 >gb|EMS53418.1| hypothetical protein TRIUR3_10557 [Triticum urartu] Length = 688 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -3 Query: 224 DIKTIRIVSSHEFPYDISAFGWGGPSFARSLSARRTTWLV 105 DIKTIRIVSS EFPYDISA GWGGPSFARSLSARRTTWL+ Sbjct: 168 DIKTIRIVSSREFPYDISALGWGGPSFARSLSARRTTWLL 207 >ref|XP_003588264.1| hypothetical protein MTR_1g005050 [Medicago truncatula] gi|355477312|gb|AES58515.1| hypothetical protein MTR_1g005050 [Medicago truncatula] Length = 334 Score = 53.9 bits (128), Expect(2) = 1e-10 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = +1 Query: 241 NPSPGWLVSLVIGDYLAWFGEHLL 312 N SPGWLVSLVIGDYLAWFGEHLL Sbjct: 291 NQSPGWLVSLVIGDYLAWFGEHLL 314 Score = 37.7 bits (86), Expect(2) = 1e-10 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +3 Query: 150 WPTPPKSAYVIWELM 194 WP+PPKSAYVIWELM Sbjct: 276 WPSPPKSAYVIWELM 290 >gb|EXB37612.1| hypothetical protein L484_021818 [Morus notabilis] Length = 167 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +3 Query: 150 WPTPPKSAYVIWELMAGNNPYGFDIR 227 WP+PPKSAYVIWELMAGNNPYGFDIR Sbjct: 13 WPSPPKSAYVIWELMAGNNPYGFDIR 38