BLASTX nr result
ID: Akebia25_contig00059827
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00059827 (357 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004564046.1| Ycf2 protein [Olea woodiana subsp. woodiana]... 64 2e-08 emb|CBR23873.1| Ycf2 protein [Olea europaea subsp. cuspidata] gi... 64 2e-08 ref|YP_004376463.1| Ycf2 protein [Olea europaea subsp. europaea]... 64 2e-08 ref|YP_003359401.1| Ycf2 (chloroplast) [Olea europaea] gi|283795... 64 2e-08 ref|YP_008965573.1| hypothetical chloroplast RF21 [Conopholis am... 63 5e-08 gb|AEK78293.1| hypothetical chloroplast RF2 [Talinum paniculatum] 63 5e-08 gb|AGW04863.1| hypothetical chloroplast protein [Sisyranthus tri... 62 6e-08 gb|AGW04559.1| hypothetical chloroplast protein [Eustegia minuta] 62 6e-08 gb|AGW04329.1| hypothetical chloroplast protein [Secamone afzelii] 62 6e-08 ref|YP_538978.1| Ycf2 [Gossypium hirsutum] gi|91208964|ref|YP_53... 62 6e-08 ref|YP_008992938.1| hypothetical chloroplast RF21 (chloroplast) ... 62 6e-08 ref|YP_008992852.1| hypothetical chloroplast RF21 (chloroplast) ... 62 6e-08 ref|YP_008992766.1| hypothetical chloroplast RF21 (chloroplast) ... 62 6e-08 ref|YP_008992680.1| hypothetical chloroplast RF21 (chloroplast) ... 62 6e-08 ref|YP_008992593.1| hypothetical chloroplast RF21 (chloroplast) ... 62 6e-08 ref|YP_006503651.1| Ycf2 (chloroplast) [Gossypium robinsonii] gi... 62 6e-08 ref|YP_006503402.1| Ycf2 (chloroplast) [Gossypium somalense] gi|... 62 6e-08 ref|YP_006503319.1| Ycf2 (chloroplast) [Gossypium incanum] gi|39... 62 6e-08 ref|YP_006503485.1| Ycf2 (chloroplast) [Gossypium capitis-viridi... 62 6e-08 gb|AEB90554.1| Ycf2 (chloroplast) [Gossypium hirsutum] gi|329317... 62 6e-08 >ref|YP_004564046.1| Ycf2 protein [Olea woodiana subsp. woodiana] gi|334701681|ref|YP_004564066.1| Ycf2 protein [Olea woodiana subsp. woodiana] gi|334084701|emb|CBS29394.1| Ycf2 protein [Olea woodiana subsp. woodiana] gi|334084721|emb|CBS29415.1| Ycf2 protein [Olea woodiana subsp. woodiana] Length = 2165 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -3 Query: 238 VLISHYQTITYS*TSCGTNTFHFPSRGKSFSIGLALS 128 V ++HYQTITYS TSCGTNTFHFPS GK FS+ LALS Sbjct: 1465 VFLAHYQTITYSQTSCGTNTFHFPSHGKPFSLRLALS 1501 >emb|CBR23873.1| Ycf2 protein [Olea europaea subsp. cuspidata] gi|334084463|emb|CBR23893.1| Ycf2 protein [Olea europaea subsp. cuspidata] Length = 2165 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -3 Query: 238 VLISHYQTITYS*TSCGTNTFHFPSRGKSFSIGLALS 128 V ++HYQTITYS TSCGTNTFHFPS GK FS+ LALS Sbjct: 1465 VFLAHYQTITYSQTSCGTNTFHFPSHGKPFSLRLALS 1501 >ref|YP_004376463.1| Ycf2 protein [Olea europaea subsp. europaea] gi|330850805|ref|YP_004376483.1| Ycf2 protein [Olea europaea subsp. europaea] gi|334700324|ref|YP_004563823.1| Ycf2 protein [Olea europaea subsp. cuspidata] gi|334700344|ref|YP_004563843.1| Ycf2 protein [Olea europaea subsp. cuspidata] gi|334701930|ref|YP_004564539.1| Ycf2 protein [Olea europaea subsp. maroccana] gi|334701950|ref|YP_004564559.1| Ycf2 protein [Olea europaea subsp. maroccana] gi|328795475|emb|CBR30357.1| Ycf2 protein [Olea europaea subsp. europaea] gi|328795495|emb|CBR30377.1| Ycf2 protein [Olea europaea subsp. europaea] gi|334084529|emb|CBR24666.1| Ycf2 protein [Olea europaea subsp. europaea] gi|334084549|emb|CBR24687.1| Ycf2 protein [Olea europaea subsp. europaea] gi|334084615|emb|CBR30450.1| Ycf2 protein [Olea europaea subsp. europaea] gi|334084635|emb|CBR30471.1| Ycf2 protein [Olea europaea subsp. europaea] gi|334084906|emb|CBS29285.1| Ycf2 protein [Olea europaea subsp. maroccana] gi|334084926|emb|CBS29312.1| Ycf2 protein [Olea europaea subsp. maroccana] gi|334084992|emb|CBJ04340.1| Ycf2 protein [Olea europaea subsp. cuspidata] gi|334085012|emb|CBJ04360.1| Ycf2 protein [Olea europaea subsp. cuspidata] gi|334085078|emb|CBR23781.1| Ycf2 protein [Olea europaea subsp. cuspidata] gi|334085098|emb|CBR23801.1| Ycf2 protein [Olea europaea subsp. cuspidata] gi|510934446|emb|CCQ09144.1| Ycf2 protein (chloroplast) [Olea europaea subsp. europaea] gi|510934466|emb|CCQ09164.1| Ycf2 prot (chloroplast) [Olea europaea subsp. europaea] Length = 2165 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -3 Query: 238 VLISHYQTITYS*TSCGTNTFHFPSRGKSFSIGLALS 128 V ++HYQTITYS TSCGTNTFHFPS GK FS+ LALS Sbjct: 1465 VFLAHYQTITYSQTSCGTNTFHFPSHGKPFSLRLALS 1501 >ref|YP_003359401.1| Ycf2 (chloroplast) [Olea europaea] gi|283795030|ref|YP_003359421.1| Ycf2 (chloroplast) [Olea europaea] gi|281428729|gb|ADA69968.1| Ycf2 (chloroplast) [Olea europaea] gi|281428749|gb|ADA69988.1| Ycf2 (chloroplast) [Olea europaea] gi|291059296|gb|ADD72132.1| hypothetical chloroplast RF21 [Olea europaea] gi|291059317|gb|ADD72153.1| hypothetical chloroplast RF21 [Olea europaea] Length = 2277 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -3 Query: 238 VLISHYQTITYS*TSCGTNTFHFPSRGKSFSIGLALS 128 V ++HYQTITYS TSCGTNTFHFPS GK FS+ LALS Sbjct: 1577 VFLAHYQTITYSQTSCGTNTFHFPSHGKPFSLRLALS 1613 >ref|YP_008965573.1| hypothetical chloroplast RF21 [Conopholis americana] gi|566553783|emb|CDI02759.1| hypothetical chloroplast RF21 [Conopholis americana] Length = 2258 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -3 Query: 238 VLISHYQTITYS*TSCGTNTFHFPSRGKSFSIGLALS 128 V ++HYQTITYS TSCGTNTF+FPS GK FSI LALS Sbjct: 1568 VFLAHYQTITYSQTSCGTNTFYFPSHGKPFSIRLALS 1604 >gb|AEK78293.1| hypothetical chloroplast RF2 [Talinum paniculatum] Length = 2199 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 238 VLISHYQTITYS*TSCGTNTFHFPSRGKSFSIGLALS 128 V ++HYQTITYS TSCG N+FHFPSRGK FS+ LALS Sbjct: 1580 VFLAHYQTITYSQTSCGANSFHFPSRGKPFSLRLALS 1616 >gb|AGW04863.1| hypothetical chloroplast protein [Sisyranthus trichostomus] Length = 2294 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 238 VLISHYQTITYS*TSCGTNTFHFPSRGKSFSIGLALS 128 + ++HYQTITYS TSCGTN+FHFPS GK FS+ LALS Sbjct: 1579 IFLAHYQTITYSQTSCGTNSFHFPSHGKPFSLRLALS 1615 >gb|AGW04559.1| hypothetical chloroplast protein [Eustegia minuta] Length = 2320 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 238 VLISHYQTITYS*TSCGTNTFHFPSRGKSFSIGLALS 128 + ++HYQTITYS TSCGTN+FHFPS GK FS+ LALS Sbjct: 1559 IFLAHYQTITYSQTSCGTNSFHFPSHGKPFSLRLALS 1595 >gb|AGW04329.1| hypothetical chloroplast protein [Secamone afzelii] Length = 2279 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 238 VLISHYQTITYS*TSCGTNTFHFPSRGKSFSIGLALS 128 + ++HYQTITYS TSCGTN+FHFPS GK FS+ LALS Sbjct: 1582 IFLAHYQTITYSQTSCGTNSFHFPSHGKPFSLRLALS 1618 >ref|YP_538978.1| Ycf2 [Gossypium hirsutum] gi|91208964|ref|YP_538997.1| Ycf2 [Gossypium hirsutum] gi|372291071|ref|YP_005087831.1| Ycf2 (chloroplast) [Gossypium darwinii] gi|372291087|ref|YP_005087848.1| Ycf2 (chloroplast) [Gossypium darwinii] gi|372291814|ref|YP_005088958.1| Ycf2 (chloroplast) [Gossypium mustelinum] gi|372291829|ref|YP_005088975.1| Ycf2 (chloroplast) [Gossypium mustelinum] gi|109896299|sp|Q2L949.1|YCF2_GOSHI RecName: Full=Protein Ycf2 gi|85687457|gb|ABC73669.1| hypothetical chloroplast RF2 [Gossypium hirsutum] gi|85687478|gb|ABC73690.1| hypothetical chloroplast RF2 [Gossypium hirsutum] gi|318084439|gb|ADV38914.1| Ycf2 (chloroplast) [Gossypium darwinii] gi|318084455|gb|ADV38930.1| Ycf2 (chloroplast) [Gossypium darwinii] gi|318084609|gb|ADV39082.1| Ycf2 (chloroplast) [Gossypium mustelinum] gi|318084624|gb|ADV39097.1| Ycf2 (chloroplast) [Gossypium mustelinum] gi|329317280|gb|AEB90637.1| ycf2 (chloroplast) [Gossypium hirsutum] gi|329317296|gb|AEB90653.1| Ycf2 (chloroplast) [Gossypium hirsutum] gi|329317364|gb|AEB90720.1| ycf2 (chloroplast) [Gossypium barbadense] gi|329317380|gb|AEB90736.1| Ycf2 (chloroplast) [Gossypium barbadense] gi|329317448|gb|AEB90803.1| Ycf2 (chloroplast) [Gossypium barbadense] gi|329317464|gb|AEB90819.1| Ycf2 (chloroplast) [Gossypium barbadense] gi|329317532|gb|AEB90886.1| ycf2 (chloroplast) [Gossypium barbadense] gi|329317548|gb|AEB90902.1| Ycf2 (chloroplast) [Gossypium barbadense] Length = 2298 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 238 VLISHYQTITYS*TSCGTNTFHFPSRGKSFSIGLALS 128 + ++HYQTITYS TSCG N+FHFPSRGK FS+ LALS Sbjct: 1593 IFLAHYQTITYSQTSCGANSFHFPSRGKPFSLRLALS 1629 >ref|YP_008992938.1| hypothetical chloroplast RF21 (chloroplast) [Gossypium sturtianum] gi|326457519|gb|ADZ74778.1| hypothetical chloroplast RF21 [Gossypium sturtianum] Length = 2298 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 238 VLISHYQTITYS*TSCGTNTFHFPSRGKSFSIGLALS 128 + ++HYQTITYS TSCG N+FHFPSRGK FS+ LALS Sbjct: 1595 IFLAHYQTITYSQTSCGANSFHFPSRGKPFSLRLALS 1631 >ref|YP_008992852.1| hypothetical chloroplast RF21 (chloroplast) [Gossypium stocksii] gi|570879979|ref|YP_008992871.1| hypothetical chloroplast RF21 (chloroplast) [Gossypium stocksii] gi|326457431|gb|ADZ74691.1| hypothetical chloroplast RF21 [Gossypium stocksii] gi|326457454|gb|ADZ74714.1| hypothetical chloroplast RF21 [Gossypium stocksii] Length = 2296 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 238 VLISHYQTITYS*TSCGTNTFHFPSRGKSFSIGLALS 128 + ++HYQTITYS TSCG N+FHFPSRGK FS+ LALS Sbjct: 1593 IFLAHYQTITYSQTSCGANSFHFPSRGKPFSLRLALS 1629 >ref|YP_008992766.1| hypothetical chloroplast RF21 (chloroplast) [Gossypium longicalyx] gi|570759726|ref|YP_008992785.1| hypothetical chloroplast RF21 (chloroplast) [Gossypium longicalyx] gi|326457343|gb|ADZ74604.1| hypothetical chloroplast RF21 [Gossypium longicalyx] gi|326457365|gb|ADZ74626.1| hypothetical chloroplast RF21 [Gossypium longicalyx] Length = 2298 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 238 VLISHYQTITYS*TSCGTNTFHFPSRGKSFSIGLALS 128 + ++HYQTITYS TSCG N+FHFPSRGK FS+ LALS Sbjct: 1595 IFLAHYQTITYSQTSCGANSFHFPSRGKPFSLRLALS 1631 >ref|YP_008992680.1| hypothetical chloroplast RF21 (chloroplast) [Gossypium herbaceum] gi|570759640|ref|YP_008992699.1| hypothetical chloroplast RF21 (chloroplast) [Gossypium herbaceum] gi|326457258|gb|ADZ74520.1| hypothetical chloroplast RF21 [Gossypium herbaceum] gi|326457279|gb|ADZ74541.1| hypothetical chloroplast RF21 [Gossypium herbaceum] Length = 2298 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 238 VLISHYQTITYS*TSCGTNTFHFPSRGKSFSIGLALS 128 + ++HYQTITYS TSCG N+FHFPSRGK FS+ LALS Sbjct: 1595 IFLAHYQTITYSQTSCGANSFHFPSRGKPFSLRLALS 1631 >ref|YP_008992593.1| hypothetical chloroplast RF21 (chloroplast) [Gossypium bickii] gi|570759034|ref|YP_008992613.1| hypothetical chloroplast RF21 (chloroplast) [Gossypium bickii] gi|326457169|gb|ADZ74432.1| hypothetical chloroplast RF21 [Gossypium bickii] gi|326457193|gb|ADZ74456.1| hypothetical chloroplast RF21 [Gossypium bickii] Length = 2298 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 238 VLISHYQTITYS*TSCGTNTFHFPSRGKSFSIGLALS 128 + ++HYQTITYS TSCG N+FHFPSRGK FS+ LALS Sbjct: 1595 IFLAHYQTITYSQTSCGANSFHFPSRGKPFSLRLALS 1631 >ref|YP_006503651.1| Ycf2 (chloroplast) [Gossypium robinsonii] gi|394831032|ref|YP_006503668.1| Ycf2 (chloroplast) [Gossypium robinsonii] gi|335354708|gb|AEH43324.1| Ycf2 [Gossypium robinsonii] gi|335354724|gb|AEH43340.1| Ycf2 [Gossypium robinsonii] Length = 2298 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 238 VLISHYQTITYS*TSCGTNTFHFPSRGKSFSIGLALS 128 + ++HYQTITYS TSCG N+FHFPSRGK FS+ LALS Sbjct: 1595 IFLAHYQTITYSQTSCGANSFHFPSRGKPFSLRLALS 1631 >ref|YP_006503402.1| Ycf2 (chloroplast) [Gossypium somalense] gi|394830770|ref|YP_006503419.1| Ycf2 (chloroplast) [Gossypium somalense] gi|394830929|ref|YP_006503568.1| Ycf2 (chloroplast) [Gossypium areysianum] gi|394830945|ref|YP_006503585.1| Ycf2 (chloroplast) [Gossypium areysianum] gi|335354456|gb|AEH43075.1| Ycf2 [Gossypium somalense] gi|335354472|gb|AEH43091.1| Ycf2 [Gossypium somalense] gi|335354624|gb|AEH43241.1| Ycf2 (chloroplast) [Gossypium areysianum] gi|335354640|gb|AEH43257.1| Ycf2 (chloroplast) [Gossypium areysianum] Length = 2298 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 238 VLISHYQTITYS*TSCGTNTFHFPSRGKSFSIGLALS 128 + ++HYQTITYS TSCG N+FHFPSRGK FS+ LALS Sbjct: 1595 IFLAHYQTITYSQTSCGANSFHFPSRGKPFSLRLALS 1631 >ref|YP_006503319.1| Ycf2 (chloroplast) [Gossypium incanum] gi|394830683|ref|YP_006503336.1| Ycf2 (chloroplast) [Gossypium incanum] gi|335354372|gb|AEH42992.1| Ycf2 [Gossypium incanum] gi|335354388|gb|AEH43008.1| Ycf2 [Gossypium incanum] Length = 2298 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 238 VLISHYQTITYS*TSCGTNTFHFPSRGKSFSIGLALS 128 + ++HYQTITYS TSCG N+FHFPSRGK FS+ LALS Sbjct: 1595 IFLAHYQTITYSQTSCGANSFHFPSRGKPFSLRLALS 1631 >ref|YP_006503485.1| Ycf2 (chloroplast) [Gossypium capitis-viridis] gi|394830856|ref|YP_006503502.1| Ycf2 (chloroplast) [Gossypium capitis-viridis] gi|570758921|ref|YP_008992507.1| hypothetical chloroplast RF21 (chloroplast) [Gossypium anomalum] gi|570758946|ref|YP_008992526.1| hypothetical chloroplast RF21 (chloroplast) [Gossypium anomalum] gi|326457080|gb|ADZ74344.1| hypothetical chloroplast RF21 [Gossypium anomalum] gi|326457105|gb|ADZ74369.1| hypothetical chloroplast RF21 [Gossypium anomalum] gi|335354540|gb|AEH43158.1| Ycf2 (chloroplast) [Gossypium capitis-viridis] gi|335354556|gb|AEH43174.1| Ycf2 (chloroplast) [Gossypium capitis-viridis] Length = 2302 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 238 VLISHYQTITYS*TSCGTNTFHFPSRGKSFSIGLALS 128 + ++HYQTITYS TSCG N+FHFPSRGK FS+ LALS Sbjct: 1595 IFLAHYQTITYSQTSCGANSFHFPSRGKPFSLRLALS 1631 >gb|AEB90554.1| Ycf2 (chloroplast) [Gossypium hirsutum] gi|329317212|gb|AEB90570.1| Ycf2 (chloroplast) [Gossypium hirsutum] Length = 2298 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 238 VLISHYQTITYS*TSCGTNTFHFPSRGKSFSIGLALS 128 + ++HYQTITYS TSCG N+FHFPSRGK FS+ LALS Sbjct: 1593 IFLAHYQTITYSQTSCGANSFHFPSRGKPFSLRLALS 1629