BLASTX nr result
ID: Akebia25_contig00059583
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00059583 (256 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD00897.1| hypothetical protein BAUCODRAFT_566674 [Baudoinia... 59 5e-07 >gb|EMD00897.1| hypothetical protein BAUCODRAFT_566674 [Baudoinia compniacensis UAMH 10762] Length = 1394 Score = 59.3 bits (142), Expect = 5e-07 Identities = 33/70 (47%), Positives = 42/70 (60%), Gaps = 1/70 (1%) Frame = +3 Query: 48 WSPIDRXXXXXXXXXXXXXXXXXLKFSRDRSKSDLSRENGMEVHPDTKAADAVVLKD-PI 224 WSP+ R L+FSR+RSKSDLS+E +E+HP TK D VV++D P+ Sbjct: 1307 WSPVGRGDADS------------LRFSRERSKSDLSKEMPLEIHPATKKDDHVVVEDNPV 1354 Query: 225 ARAGGVPPSQ 254 AGG PPSQ Sbjct: 1355 EVAGGAPPSQ 1364