BLASTX nr result
ID: Akebia25_contig00059568
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00059568 (225 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMP26551.1| Ubiquitin-like modifier-activating enzyme 1 [Chel... 59 9e-07 gb|EZF32517.1| GTP-binding protein rhoA, partial [Trichophyton i... 58 1e-06 ref|XP_006117685.1| PREDICTED: transforming protein RhoA isoform... 58 2e-06 gb|EMP35984.1| Rho-related GTP-binding protein RhoC [Chelonia my... 57 2e-06 ref|XP_003034172.1| hypothetical protein SCHCODRAFT_84690 [Schiz... 57 3e-06 gb|EYE99461.1| GTP-binding protein rhoA [Aspergillus ruber CBS 1... 56 5e-06 gb|EXJ86199.1| GTP-binding protein rhoA [Capronia coronata CBS 6... 56 5e-06 gb|EXJ77647.1| GTP-binding protein rhoA [Capronia epimyces CBS 6... 56 5e-06 ref|XP_007592376.1| Ras family protein [Colletotrichum fioriniae... 56 5e-06 emb|CDM35038.1| GTP-binding protein rhoA [Penicillium roqueforti] 56 5e-06 gb|EWG52531.1| GTP-binding protein rhoA [Fusarium verticillioide... 56 5e-06 ref|XP_384576.1| hypothetical protein FG04400.1 [Fusarium gramin... 56 5e-06 gb|ETS77455.1| GTP-binding protein rhoA [Pestalotiopsis fici W10... 56 5e-06 gb|ETN46909.1| GTP-binding protein rhoA [Cyphellophora europaea ... 56 5e-06 gb|ETI22499.1| GTP-binding protein rhoA [Cladophialophora carrio... 56 5e-06 gb|ERT00007.1| GTP-binding protein rhoA [Sporothrix schenckii AT... 56 5e-06 emb|CCX31080.1| Similar to GTP-binding protein rhoA; acc. no. Q9... 56 5e-06 gb|ERF76136.1| GTP-binding protein rhoA [Endocarpon pusillum Z07... 56 5e-06 gb|EQL02303.1| Small GTPase superfamily, Rho type [Ophiocordycep... 56 5e-06 gb|EPS27625.1| hypothetical protein PDE_02569 [Penicillium oxali... 56 5e-06 >gb|EMP26551.1| Ubiquitin-like modifier-activating enzyme 1 [Chelonia mydas] Length = 848 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/57 (52%), Positives = 36/57 (63%) Frame = -2 Query: 173 AGSRTHSAGFQYSQATNHTQHTSITQPTVKMAELRRKLVIVGDGACGKTCLLIVFSK 3 A S + + A H S+ + KMA +R+KLVIVGDGACGKTCLLIVFSK Sbjct: 626 AASNLRAENYDIPPADRHKAGCSLGRLGGKMAAIRKKLVIVGDGACGKTCLLIVFSK 682 >gb|EZF32517.1| GTP-binding protein rhoA, partial [Trichophyton interdigitale H6] Length = 224 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = -2 Query: 107 SITQPTVKMAELRRKLVIVGDGACGKTCLLIVFSK 3 S Q MAE+RRKLVIVGDGACGKTCLLIVFSK Sbjct: 24 STQQKAAPMAEIRRKLVIVGDGACGKTCLLIVFSK 58 >ref|XP_006117685.1| PREDICTED: transforming protein RhoA isoform X1 [Pelodiscus sinensis] Length = 217 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -2 Query: 113 HTSITQPTVKMAELRRKLVIVGDGACGKTCLLIVFSK 3 H + QP MA +R+KLVIVGDGACGKTCLLIVFSK Sbjct: 15 HIILAQPGRDMAAIRKKLVIVGDGACGKTCLLIVFSK 51 >gb|EMP35984.1| Rho-related GTP-binding protein RhoC [Chelonia mydas] Length = 561 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -2 Query: 116 QHTSITQPTVKMAELRRKLVIVGDGACGKTCLLIVFSK 3 Q T ++Q MA +R+KLVIVGDGACGKTCLLIVFSK Sbjct: 358 QRTLVSQGKYAMAAIRKKLVIVGDGACGKTCLLIVFSK 395 >ref|XP_003034172.1| hypothetical protein SCHCODRAFT_84690 [Schizophyllum commune H4-8] gi|300107867|gb|EFI99269.1| hypothetical protein SCHCODRAFT_84690 [Schizophyllum commune H4-8] Length = 194 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 83 MAELRRKLVIVGDGACGKTCLLIVFSK 3 MAELRRKLVIVGDGACGKTCLLIVFSK Sbjct: 1 MAELRRKLVIVGDGACGKTCLLIVFSK 27 >gb|EYE99461.1| GTP-binding protein rhoA [Aspergillus ruber CBS 135680] Length = 193 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 83 MAELRRKLVIVGDGACGKTCLLIVFSK 3 MAE+RRKLVIVGDGACGKTCLLIVFSK Sbjct: 1 MAEIRRKLVIVGDGACGKTCLLIVFSK 27 >gb|EXJ86199.1| GTP-binding protein rhoA [Capronia coronata CBS 617.96] Length = 193 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 83 MAELRRKLVIVGDGACGKTCLLIVFSK 3 MAE+RRKLVIVGDGACGKTCLLIVFSK Sbjct: 1 MAEIRRKLVIVGDGACGKTCLLIVFSK 27 >gb|EXJ77647.1| GTP-binding protein rhoA [Capronia epimyces CBS 606.96] Length = 216 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 83 MAELRRKLVIVGDGACGKTCLLIVFSK 3 MAE+RRKLVIVGDGACGKTCLLIVFSK Sbjct: 1 MAEIRRKLVIVGDGACGKTCLLIVFSK 27 >ref|XP_007592376.1| Ras family protein [Colletotrichum fioriniae PJ7] gi|588903919|gb|EXF83972.1| Ras family protein [Colletotrichum fioriniae PJ7] Length = 234 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 83 MAELRRKLVIVGDGACGKTCLLIVFSK 3 MAE+RRKLVIVGDGACGKTCLLIVFSK Sbjct: 1 MAEIRRKLVIVGDGACGKTCLLIVFSK 27 >emb|CDM35038.1| GTP-binding protein rhoA [Penicillium roqueforti] Length = 198 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 83 MAELRRKLVIVGDGACGKTCLLIVFSK 3 MAE+RRKLVIVGDGACGKTCLLIVFSK Sbjct: 1 MAEIRRKLVIVGDGACGKTCLLIVFSK 27 >gb|EWG52531.1| GTP-binding protein rhoA [Fusarium verticillioides 7600] Length = 195 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 83 MAELRRKLVIVGDGACGKTCLLIVFSK 3 MAE+RRKLVIVGDGACGKTCLLIVFSK Sbjct: 1 MAEIRRKLVIVGDGACGKTCLLIVFSK 27 >ref|XP_384576.1| hypothetical protein FG04400.1 [Fusarium graminearum PH-1] gi|408389164|gb|EKJ68642.1| hypothetical protein FPSE_11169 [Fusarium pseudograminearum CS3096] gi|558858624|gb|ESU08707.1| hypothetical protein FGSG_04400 [Fusarium graminearum PH-1] gi|596544802|gb|EYB24922.1| hypothetical protein FG05_04400 [Fusarium graminearum] Length = 195 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 83 MAELRRKLVIVGDGACGKTCLLIVFSK 3 MAE+RRKLVIVGDGACGKTCLLIVFSK Sbjct: 1 MAEIRRKLVIVGDGACGKTCLLIVFSK 27 >gb|ETS77455.1| GTP-binding protein rhoA [Pestalotiopsis fici W106-1] Length = 195 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 83 MAELRRKLVIVGDGACGKTCLLIVFSK 3 MAE+RRKLVIVGDGACGKTCLLIVFSK Sbjct: 1 MAEIRRKLVIVGDGACGKTCLLIVFSK 27 >gb|ETN46909.1| GTP-binding protein rhoA [Cyphellophora europaea CBS 101466] Length = 193 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 83 MAELRRKLVIVGDGACGKTCLLIVFSK 3 MAE+RRKLVIVGDGACGKTCLLIVFSK Sbjct: 1 MAEIRRKLVIVGDGACGKTCLLIVFSK 27 >gb|ETI22499.1| GTP-binding protein rhoA [Cladophialophora carrionii CBS 160.54] gi|589975239|gb|EXJ58540.1| rho family, other [Cladophialophora yegresii CBS 114405] gi|589984989|gb|EXJ68035.1| rho family, other [Cladophialophora psammophila CBS 110553] Length = 193 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 83 MAELRRKLVIVGDGACGKTCLLIVFSK 3 MAE+RRKLVIVGDGACGKTCLLIVFSK Sbjct: 1 MAEIRRKLVIVGDGACGKTCLLIVFSK 27 >gb|ERT00007.1| GTP-binding protein rhoA [Sporothrix schenckii ATCC 58251] Length = 196 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 83 MAELRRKLVIVGDGACGKTCLLIVFSK 3 MAE+RRKLVIVGDGACGKTCLLIVFSK Sbjct: 1 MAEIRRKLVIVGDGACGKTCLLIVFSK 27 >emb|CCX31080.1| Similar to GTP-binding protein rhoA; acc. no. Q9C3Y4 [Pyronema omphalodes CBS 100304] Length = 193 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 83 MAELRRKLVIVGDGACGKTCLLIVFSK 3 MAE+RRKLVIVGDGACGKTCLLIVFSK Sbjct: 1 MAEIRRKLVIVGDGACGKTCLLIVFSK 27 >gb|ERF76136.1| GTP-binding protein rhoA [Endocarpon pusillum Z07020] Length = 192 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 83 MAELRRKLVIVGDGACGKTCLLIVFSK 3 MAE+RRKLVIVGDGACGKTCLLIVFSK Sbjct: 1 MAEIRRKLVIVGDGACGKTCLLIVFSK 27 >gb|EQL02303.1| Small GTPase superfamily, Rho type [Ophiocordyceps sinensis CO18] Length = 196 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 83 MAELRRKLVIVGDGACGKTCLLIVFSK 3 MAE+RRKLVIVGDGACGKTCLLIVFSK Sbjct: 1 MAEIRRKLVIVGDGACGKTCLLIVFSK 27 >gb|EPS27625.1| hypothetical protein PDE_02569 [Penicillium oxalicum 114-2] Length = 196 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 83 MAELRRKLVIVGDGACGKTCLLIVFSK 3 MAE+RRKLVIVGDGACGKTCLLIVFSK Sbjct: 1 MAEIRRKLVIVGDGACGKTCLLIVFSK 27