BLASTX nr result
ID: Akebia25_contig00059549
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00059549 (264 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002440822.1| hypothetical protein SORBIDRAFT_09g007400 [S... 56 5e-06 >ref|XP_002440822.1| hypothetical protein SORBIDRAFT_09g007400 [Sorghum bicolor] gi|241946107|gb|EES19252.1| hypothetical protein SORBIDRAFT_09g007400 [Sorghum bicolor] Length = 835 Score = 56.2 bits (134), Expect = 5e-06 Identities = 34/83 (40%), Positives = 51/83 (61%), Gaps = 2/83 (2%) Frame = -2 Query: 245 ISNNSYLITKSLN-FPILPVTLDPLSFS*L-RINKLCRNFL*HEKDGKSKFHLMSWDKIC 72 I+ S LI+ SLN PI +++ L S + R++K+ RNF K K+HL+ W KIC Sbjct: 407 IAGRSTLISSSLNNAPIYHMSIYLLPKSVIGRLDKIRRNFFWQGGSTKQKYHLIKWTKIC 466 Query: 71 VLKFLGGLGLKNVGLMNITLLCK 3 K GG+G+K++ MN++LL K Sbjct: 467 RSKKKGGIGIKDIRKMNVSLLIK 489