BLASTX nr result
ID: Akebia25_contig00059498
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00059498 (318 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EGE86846.1| BAP31 domain-containing protein [Ajellomyces derm... 57 3e-06 gb|EEQ89833.1| BAP31 domain-containing protein [Ajellomyces derm... 57 3e-06 ref|XP_002621386.1| BAP31 domain-containing protein [Ajellomyces... 57 3e-06 gb|EEH50714.1| conserved hypothetical protein [Paracoccidioides ... 57 3e-06 ref|XP_002792714.1| conserved hypothetical protein [Paracoccidio... 57 3e-06 gb|ETN37556.1| hypothetical protein HMPREF1541_07178 [Cyphelloph... 57 3e-06 ref|XP_001819679.1| BAP31 domain protein [Aspergillus oryzae RIB... 56 6e-06 gb|EGC44286.1| BAP31 domain-containing protein [Ajellomyces caps... 56 6e-06 gb|EER38158.1| receptor-associated protein [Ajellomyces capsulat... 56 6e-06 ref|XP_001542213.1| conserved hypothetical protein [Ajellomyces ... 56 6e-06 gb|EXJ66349.1| hypothetical protein A1O5_10501 [Cladophialophora... 55 8e-06 >gb|EGE86846.1| BAP31 domain-containing protein [Ajellomyces dermatitidis ATCC 18188] gi|531987331|gb|EQL37918.1| hypothetical protein, variant [Ajellomyces dermatitidis ATCC 26199] Length = 213 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -2 Query: 98 MTLYYSLVFLLLVAEMVVFMGLIIPMPYNIKR 3 MTLYYSLVFLLLV EMV+F+GLIIP+P+ +KR Sbjct: 1 MTLYYSLVFLLLVVEMVIFVGLIIPLPFTVKR 32 >gb|EEQ89833.1| BAP31 domain-containing protein [Ajellomyces dermatitidis ER-3] gi|531987332|gb|EQL37919.1| hypothetical protein BDFG_00943 [Ajellomyces dermatitidis ATCC 26199] Length = 215 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -2 Query: 98 MTLYYSLVFLLLVAEMVVFMGLIIPMPYNIKR 3 MTLYYSLVFLLLV EMV+F+GLIIP+P+ +KR Sbjct: 1 MTLYYSLVFLLLVVEMVIFVGLIIPLPFTVKR 32 >ref|XP_002621386.1| BAP31 domain-containing protein [Ajellomyces dermatitidis SLH14081] gi|239591622|gb|EEQ74203.1| BAP31 domain-containing protein [Ajellomyces dermatitidis SLH14081] Length = 215 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -2 Query: 98 MTLYYSLVFLLLVAEMVVFMGLIIPMPYNIKR 3 MTLYYSLVFLLLV EMV+F+GLIIP+P+ +KR Sbjct: 1 MTLYYSLVFLLLVVEMVIFVGLIIPLPFTVKR 32 >gb|EEH50714.1| conserved hypothetical protein [Paracoccidioides brasiliensis Pb18] Length = 213 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -2 Query: 98 MTLYYSLVFLLLVAEMVVFMGLIIPMPYNIKR 3 MTLYYSLVFLLLV EMV+F+GLIIP+P+ +KR Sbjct: 1 MTLYYSLVFLLLVVEMVIFVGLIIPLPFTVKR 32 >ref|XP_002792714.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' Pb01] gi|226278828|gb|EEH34394.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' Pb01] Length = 213 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -2 Query: 98 MTLYYSLVFLLLVAEMVVFMGLIIPMPYNIKR 3 MTLYYSLVFLLLV EMV+F+GLIIP+P+ +KR Sbjct: 1 MTLYYSLVFLLLVVEMVIFVGLIIPLPFTVKR 32 >gb|ETN37556.1| hypothetical protein HMPREF1541_07178 [Cyphellophora europaea CBS 101466] Length = 216 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -2 Query: 98 MTLYYSLVFLLLVAEMVVFMGLIIPMPYNIKR 3 MTLYYSLVF+LL+AEM +FMGLIIPMP+ +KR Sbjct: 1 MTLYYSLVFVLLMAEMALFMGLIIPMPFTVKR 32 >ref|XP_001819679.1| BAP31 domain protein [Aspergillus oryzae RIB40] gi|238487168|ref|XP_002374822.1| BAP31 domain protein, putative [Aspergillus flavus NRRL3357] gi|83767538|dbj|BAE57677.1| unnamed protein product [Aspergillus oryzae RIB40] gi|220699701|gb|EED56040.1| BAP31 domain protein, putative [Aspergillus flavus NRRL3357] gi|391867336|gb|EIT76582.1| B-cell receptor-associated protein [Aspergillus oryzae 3.042] Length = 210 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 98 MTLYYSLVFLLLVAEMVVFMGLIIPMPYNIKR 3 MTLYYSLVF LLV EMV+FMGLI+P+P+ IKR Sbjct: 1 MTLYYSLVFCLLVFEMVIFMGLIVPLPFTIKR 32 >gb|EGC44286.1| BAP31 domain-containing protein [Ajellomyces capsulatus H88] Length = 213 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -2 Query: 98 MTLYYSLVFLLLVAEMVVFMGLIIPMPYNIKR 3 MTLYYSLVFLLLV EMV+F+GLIIP+P+ +K+ Sbjct: 1 MTLYYSLVFLLLVVEMVIFVGLIIPLPFTVKK 32 >gb|EER38158.1| receptor-associated protein [Ajellomyces capsulatus H143] Length = 204 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -2 Query: 98 MTLYYSLVFLLLVAEMVVFMGLIIPMPYNIKR 3 MTLYYSLVFLLLV EMV+F+GLIIP+P+ +K+ Sbjct: 1 MTLYYSLVFLLLVVEMVIFVGLIIPLPFTVKK 32 >ref|XP_001542213.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1] gi|150410393|gb|EDN05781.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1] Length = 215 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -2 Query: 98 MTLYYSLVFLLLVAEMVVFMGLIIPMPYNIKR 3 MTLYYSLVFLLLV EMV+F+GLIIP+P+ +K+ Sbjct: 1 MTLYYSLVFLLLVVEMVIFVGLIIPLPFTVKK 32 >gb|EXJ66349.1| hypothetical protein A1O5_10501 [Cladophialophora psammophila CBS 110553] Length = 214 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -2 Query: 98 MTLYYSLVFLLLVAEMVVFMGLIIPMPYNIKR 3 MTLYYSLVF+LLVAEMV+F+ LI+PMP+ +KR Sbjct: 1 MTLYYSLVFVLLVAEMVMFLALIVPMPFTVKR 32