BLASTX nr result
ID: Akebia25_contig00059350
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00059350 (233 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD58210.1| hypothetical protein COCSADRAFT_104431, partial [... 78 1e-12 gb|EQL27844.1| hypothetical protein BDFG_09353 [Ajellomyces derm... 52 1e-09 gb|EGC42647.1| transcript antisense to ribosomal RNA protein [Aj... 60 2e-07 gb|EJT42883.1| YLR154W-A-like protein [Saccharomyces kudriavzevi... 57 2e-06 ref|XP_003851051.1| hypothetical protein MYCGRDRAFT_30981, parti... 47 4e-06 ref|XP_007416290.1| hypothetical protein MELLADRAFT_93284 [Melam... 56 6e-06 gb|EME38018.1| hypothetical protein DOTSEDRAFT_109051, partial [... 48 7e-06 >gb|EMD58210.1| hypothetical protein COCSADRAFT_104431, partial [Bipolaris sorokiniana ND90Pr] Length = 54 Score = 77.8 bits (190), Expect = 1e-12 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = -2 Query: 178 RVVICRGCLADGAALSPLEQGVTEGESPVCGWMPDACEAPSTSRVVWECSSKWEVNFF 5 RVVICRG G+ S LEQ VTEGE+P+ C+APSTSRVVWECSSKWEVNFF Sbjct: 2 RVVICRGRFGFGSGPSSLEQDVTEGENPLL-----PCKAPSTSRVVWECSSKWEVNFF 54 >gb|EQL27844.1| hypothetical protein BDFG_09353 [Ajellomyces dermatitidis ATCC 26199] Length = 98 Score = 52.0 bits (123), Expect(2) = 1e-09 Identities = 23/34 (67%), Positives = 26/34 (76%) Frame = +3 Query: 87 PHTGLSPSVTPCSKGLRAAPSARHPLQITTRAPR 188 P TG SPS TP S+GLR P +HPLQITTRAP+ Sbjct: 7 PKTGFSPSATPRSRGLRPRPRPKHPLQITTRAPK 40 Score = 36.2 bits (82), Expect(2) = 1e-09 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +2 Query: 182 PEEPAFKFELLPLHSPL 232 P+EP FKFELLPLHSPL Sbjct: 39 PKEPDFKFELLPLHSPL 55 >gb|EGC42647.1| transcript antisense to ribosomal RNA protein [Ajellomyces capsulatus H88] Length = 199 Score = 60.5 bits (145), Expect = 2e-07 Identities = 42/88 (47%), Positives = 43/88 (48%), Gaps = 11/88 (12%) Frame = +2 Query: 2 LEEIYLPFRAAFPNNSTRRRSFTRV--------GHP---PTYGTLTLCDALFQGT*GGAV 148 L+EIY PF AAFPNNSTRRRSFTR HP P G L G Sbjct: 21 LDEIYHPFGAAFPNNSTRRRSFTRARPAGRRRDSHPLRRPVPGDLD----------RGRA 70 Query: 149 REASSTNYNAGPEEPAFKFELLPLHSPL 232 R P P FKFELLPLHSPL Sbjct: 71 RSILCKLQLRPPGGPDFKFELLPLHSPL 98 >gb|EJT42883.1| YLR154W-A-like protein [Saccharomyces kudriavzevii IFO 1802] Length = 85 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/44 (63%), Positives = 31/44 (70%) Frame = +2 Query: 2 LEEIYLPFRAAFPNNSTRRRSFTRVGHPPTYGTLTLCDALFQGT 133 L+ IY P RAAFPNNST RR FT+ H +G LTL D LFQGT Sbjct: 42 LDGIYHPLRAAFPNNSTLRRHFTKEPHSSPHGILTLYDVLFQGT 85 >ref|XP_003851051.1| hypothetical protein MYCGRDRAFT_30981, partial [Zymoseptoria tritici IPO323] gi|398395197|ref|XP_003851057.1| hypothetical protein MYCGRDRAFT_30987, partial [Zymoseptoria tritici IPO323] gi|339470930|gb|EGP86027.1| hypothetical protein MYCGRDRAFT_30981 [Zymoseptoria tritici IPO323] gi|339470936|gb|EGP86033.1| hypothetical protein MYCGRDRAFT_30987 [Zymoseptoria tritici IPO323] Length = 80 Score = 47.4 bits (111), Expect(2) = 4e-06 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +2 Query: 2 LEEIYLPFRAAFPNNSTRRRSF 67 LEEIYLPFRAAFPNNSTRRRS+ Sbjct: 37 LEEIYLPFRAAFPNNSTRRRSY 58 Score = 28.9 bits (63), Expect(2) = 4e-06 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = +3 Query: 54 VEGASHASGIHPHTGLSPSVTPCSKGL 134 VEGA + HTG SPS+T CSK L Sbjct: 59 VEGAGRS-----HTGFSPSMTSCSKEL 80 >ref|XP_007416290.1| hypothetical protein MELLADRAFT_93284 [Melampsora larici-populina 98AG31] gi|328851288|gb|EGG00444.1| hypothetical protein MELLADRAFT_93284 [Melampsora larici-populina 98AG31] Length = 83 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/58 (50%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = -2 Query: 178 RVVICRGCLADGAALSPLEQGVTEGESPVCGWMPDA-CEAPSTSRVVWECSSKWEVNF 8 RVVICR + G S L+ + EGE+PV C+ S SRVVWECSSKW VN+ Sbjct: 25 RVVICRTVIRAGPCTSLLKSSIIEGENPVDDMDYQCICDTVSKSRVVWECSSKWVVNY 82 >gb|EME38018.1| hypothetical protein DOTSEDRAFT_109051, partial [Dothistroma septosporum NZE10] Length = 80 Score = 48.1 bits (113), Expect(2) = 7e-06 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = +2 Query: 2 LEEIYLPFRAAFPNNSTRRRSFTR 73 LEEIYLPFRAAFPNNSTRRRS+ + Sbjct: 37 LEEIYLPFRAAFPNNSTRRRSYVK 60 Score = 27.3 bits (59), Expect(2) = 7e-06 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +3 Query: 90 HTGLSPSVTPCSKGL 134 HTG SPS+T CSK L Sbjct: 66 HTGFSPSMTSCSKEL 80