BLASTX nr result
ID: Akebia25_contig00059322
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00059322 (340 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004293181.1| PREDICTED: uncharacterized protein LOC101298... 46 1e-07 >ref|XP_004293181.1| PREDICTED: uncharacterized protein LOC101298394 [Fragaria vesca subsp. vesca] Length = 958 Score = 45.8 bits (107), Expect(2) = 1e-07 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 3/78 (3%) Frame = -2 Query: 294 LNNKFHCFAYPKKEKNNAAE---WSKVCCPKEEGGMGIKEVRLWNQTATLRLV*IITSKR 124 + + CF + AA WS++C PK EGG+GIK++ WN+ + + + S Sbjct: 661 IEKRLRCFLWAGNCSGRAATKVAWSEICLPKCEGGLGIKDLHCWNKALMISHIWNLVSSS 720 Query: 123 KCLWID*I*LTLVSPTPF 70 W D + + L+ F Sbjct: 721 SNFWTDWVKVYLLKGNSF 738 Score = 35.8 bits (81), Expect(2) = 1e-07 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -1 Query: 85 KSNPFWTV*CPLDCSWAWRKIIKARK 8 K N FW P CSW WRK++K R+ Sbjct: 734 KGNSFWNAPLPSICSWNWRKLLKIRE 759