BLASTX nr result
ID: Akebia25_contig00059302
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00059302 (241 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAO04173.1| hypothetical protein [Delphinium grandiflorum] 62 6e-08 >dbj|BAO04173.1| hypothetical protein [Delphinium grandiflorum] Length = 525 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/51 (58%), Positives = 38/51 (74%) Frame = -3 Query: 239 GLIHVDFEDKELKRQPKSSARWYSDFLKKKGMDMKNTDEAESHFEMFHSSH 87 GL+HVDFEDKELKRQ KSSA+W+S F+KK + MK T++ S + H SH Sbjct: 474 GLVHVDFEDKELKRQLKSSAQWFSSFIKKNDVLMKTTEKIRS---ISHKSH 521