BLASTX nr result
ID: Akebia25_contig00059286
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00059286 (387 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513571.1| spermidine synthase 1, putative [Ricinus com... 57 3e-06 >ref|XP_002513571.1| spermidine synthase 1, putative [Ricinus communis] gi|223547479|gb|EEF48974.1| spermidine synthase 1, putative [Ricinus communis] Length = 368 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +1 Query: 1 VDFLNPINPIEKVEGALKFRRELRFYNSEV 90 VDFLNP+NPIEK+EGA K++RELRFYNSE+ Sbjct: 308 VDFLNPVNPIEKLEGADKYKRELRFYNSEI 337