BLASTX nr result
ID: Akebia25_contig00059218
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00059218 (303 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002324235.2| pentatricopeptide repeat-containing family p... 101 1e-19 ref|XP_002274432.1| PREDICTED: pentatricopeptide repeat-containi... 101 1e-19 ref|XP_006475804.1| PREDICTED: pentatricopeptide repeat-containi... 100 4e-19 ref|XP_006450982.1| hypothetical protein CICLE_v10010823mg [Citr... 100 4e-19 gb|EXB86239.1| hypothetical protein L484_005950 [Morus notabilis] 99 6e-19 ref|XP_006364895.1| PREDICTED: pentatricopeptide repeat-containi... 98 1e-18 gb|EYU45574.1| hypothetical protein MIMGU_mgv1a001941mg [Mimulus... 98 1e-18 ref|XP_007013366.1| Pentatricopeptide repeat-containing protein,... 98 1e-18 ref|XP_004150015.1| PREDICTED: pentatricopeptide repeat-containi... 98 1e-18 ref|XP_007154976.1| hypothetical protein PHAVU_003G162300g [Phas... 95 9e-18 ref|XP_003609266.1| Pentatricopeptide repeat protein [Medicago t... 95 9e-18 ref|XP_004508527.1| PREDICTED: pentatricopeptide repeat-containi... 94 2e-17 emb|CBI28813.3| unnamed protein product [Vitis vinifera] 93 3e-17 ref|XP_002269269.1| PREDICTED: pentatricopeptide repeat-containi... 93 3e-17 emb|CBI32034.3| unnamed protein product [Vitis vinifera] 93 4e-17 ref|XP_002269101.1| PREDICTED: pentatricopeptide repeat-containi... 93 4e-17 ref|XP_004975979.1| PREDICTED: pentatricopeptide repeat-containi... 92 6e-17 ref|XP_003525660.2| PREDICTED: pentatricopeptide repeat-containi... 92 8e-17 ref|XP_007203957.1| hypothetical protein PRUPE_ppa022872mg [Prun... 91 1e-16 ref|XP_002448053.1| hypothetical protein SORBIDRAFT_06g020256 [S... 91 1e-16 >ref|XP_002324235.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550317719|gb|EEF02800.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 736 Score = 101 bits (251), Expect = 1e-19 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -3 Query: 301 KNLRVCGNCHSATKLISKIFNREIIARDRSRFHHFKDGSCSCMDYW 164 KNLRVCGNCHSATKLISKIFNREIIARDR+RFHHFKDGSCSC DYW Sbjct: 691 KNLRVCGNCHSATKLISKIFNREIIARDRNRFHHFKDGSCSCKDYW 736 >ref|XP_002274432.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Vitis vinifera] Length = 738 Score = 101 bits (251), Expect = 1e-19 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -3 Query: 301 KNLRVCGNCHSATKLISKIFNREIIARDRSRFHHFKDGSCSCMDYW 164 KNLRVCGNCHSA KLISKIFNREIIARDR+RFHHFKDGSCSCMDYW Sbjct: 693 KNLRVCGNCHSAIKLISKIFNREIIARDRNRFHHFKDGSCSCMDYW 738 >ref|XP_006475804.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Citrus sinensis] Length = 736 Score = 99.8 bits (247), Expect = 4e-19 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = -3 Query: 301 KNLRVCGNCHSATKLISKIFNREIIARDRSRFHHFKDGSCSCMDYW 164 KNLRVCGNCHSATKLISKIFNREIIARDR+RFHHFKDG+CSC DYW Sbjct: 691 KNLRVCGNCHSATKLISKIFNREIIARDRNRFHHFKDGNCSCNDYW 736 >ref|XP_006450982.1| hypothetical protein CICLE_v10010823mg [Citrus clementina] gi|557554208|gb|ESR64222.1| hypothetical protein CICLE_v10010823mg [Citrus clementina] Length = 736 Score = 99.8 bits (247), Expect = 4e-19 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = -3 Query: 301 KNLRVCGNCHSATKLISKIFNREIIARDRSRFHHFKDGSCSCMDYW 164 KNLRVCGNCHSATKLISKIFNREIIARDR+RFHHFKDG+CSC DYW Sbjct: 691 KNLRVCGNCHSATKLISKIFNREIIARDRNRFHHFKDGNCSCNDYW 736 >gb|EXB86239.1| hypothetical protein L484_005950 [Morus notabilis] Length = 737 Score = 99.0 bits (245), Expect = 6e-19 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = -3 Query: 301 KNLRVCGNCHSATKLISKIFNREIIARDRSRFHHFKDGSCSCMDYW 164 KNLRVCGNCHSATKLISKIFNREIIARDR+RFHHFK+GSCSC DYW Sbjct: 692 KNLRVCGNCHSATKLISKIFNREIIARDRNRFHHFKNGSCSCNDYW 737 >ref|XP_006364895.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Solanum tuberosum] Length = 731 Score = 98.2 bits (243), Expect = 1e-18 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = -3 Query: 301 KNLRVCGNCHSATKLISKIFNREIIARDRSRFHHFKDGSCSCMDYW 164 KNLRVCGNCH ATK+ISKIFNREIIARDR+RFHHFK+GSCSC+DYW Sbjct: 686 KNLRVCGNCHEATKMISKIFNREIIARDRNRFHHFKNGSCSCLDYW 731 >gb|EYU45574.1| hypothetical protein MIMGU_mgv1a001941mg [Mimulus guttatus] Length = 736 Score = 97.8 bits (242), Expect = 1e-18 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -3 Query: 301 KNLRVCGNCHSATKLISKIFNREIIARDRSRFHHFKDGSCSCMDYW 164 KNLRVCGNCHSATKLISK++ REIIARDRSRFH FKDGSCSCMDYW Sbjct: 691 KNLRVCGNCHSATKLISKVYGREIIARDRSRFHRFKDGSCSCMDYW 736 >ref|XP_007013366.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] gi|508783729|gb|EOY30985.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 194 Score = 97.8 bits (242), Expect = 1e-18 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -3 Query: 301 KNLRVCGNCHSATKLISKIFNREIIARDRSRFHHFKDGSCSCMDYW 164 KNLRVCGNCHSATKLISKIFN+EIIARDR+RFHHFKDG CSC DYW Sbjct: 149 KNLRVCGNCHSATKLISKIFNKEIIARDRNRFHHFKDGFCSCKDYW 194 >ref|XP_004150015.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cucumis sativus] gi|449529868|ref|XP_004171920.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cucumis sativus] Length = 734 Score = 97.8 bits (242), Expect = 1e-18 Identities = 43/46 (93%), Positives = 44/46 (95%) Frame = -3 Query: 301 KNLRVCGNCHSATKLISKIFNREIIARDRSRFHHFKDGSCSCMDYW 164 KNLRVC NCHSATKLISKIFNREIIARDR+RFHHFKDGSCSC DYW Sbjct: 689 KNLRVCRNCHSATKLISKIFNREIIARDRNRFHHFKDGSCSCNDYW 734 >ref|XP_007154976.1| hypothetical protein PHAVU_003G162300g [Phaseolus vulgaris] gi|561028330|gb|ESW26970.1| hypothetical protein PHAVU_003G162300g [Phaseolus vulgaris] Length = 733 Score = 95.1 bits (235), Expect = 9e-18 Identities = 42/46 (91%), Positives = 43/46 (93%) Frame = -3 Query: 301 KNLRVCGNCHSATKLISKIFNREIIARDRSRFHHFKDGSCSCMDYW 164 KNLRVCGNCHSATKLISKIFNREIIARDR+RFHHFKDG CSC D W Sbjct: 688 KNLRVCGNCHSATKLISKIFNREIIARDRNRFHHFKDGFCSCNDCW 733 >ref|XP_003609266.1| Pentatricopeptide repeat protein [Medicago truncatula] gi|355510321|gb|AES91463.1| Pentatricopeptide repeat protein [Medicago truncatula] Length = 738 Score = 95.1 bits (235), Expect = 9e-18 Identities = 42/46 (91%), Positives = 43/46 (93%) Frame = -3 Query: 301 KNLRVCGNCHSATKLISKIFNREIIARDRSRFHHFKDGSCSCMDYW 164 KNLRVCGNCHSATKLISKIFNREIIARDR+RFHHFKDG CSC D W Sbjct: 693 KNLRVCGNCHSATKLISKIFNREIIARDRNRFHHFKDGFCSCNDCW 738 >ref|XP_004508527.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cicer arietinum] Length = 737 Score = 94.0 bits (232), Expect = 2e-17 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -3 Query: 301 KNLRVCGNCHSATKLISKIFNREIIARDRSRFHHFKDGSCSCMDYW 164 KNLRVCGNCHSATKLISKIFNR+IIARDR+RFHHFKDG CSC D W Sbjct: 692 KNLRVCGNCHSATKLISKIFNRQIIARDRNRFHHFKDGFCSCNDCW 737 >emb|CBI28813.3| unnamed protein product [Vitis vinifera] Length = 500 Score = 93.2 bits (230), Expect = 3e-17 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = -3 Query: 301 KNLRVCGNCHSATKLISKIFNREIIARDRSRFHHFKDGSCSCMDYW 164 KNLRVC +CHSATKLISKI+NREII RDR RFHHF+DGSCSCMD+W Sbjct: 455 KNLRVCADCHSATKLISKIYNREIIVRDRCRFHHFRDGSCSCMDFW 500 >ref|XP_002269269.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vitis vinifera] Length = 640 Score = 93.2 bits (230), Expect = 3e-17 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = -3 Query: 301 KNLRVCGNCHSATKLISKIFNREIIARDRSRFHHFKDGSCSCMDYW 164 KNLRVC +CHSATKLISKI+NREII RDR RFHHF+DGSCSCMD+W Sbjct: 595 KNLRVCADCHSATKLISKIYNREIIVRDRCRFHHFRDGSCSCMDFW 640 >emb|CBI32034.3| unnamed protein product [Vitis vinifera] Length = 593 Score = 92.8 bits (229), Expect = 4e-17 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = -3 Query: 301 KNLRVCGNCHSATKLISKIFNREIIARDRSRFHHFKDGSCSCMDYW 164 KNLRVC NCH TKLIS++FNREII RDR RFHHFKDG+CSCMDYW Sbjct: 548 KNLRVCNNCHQVTKLISRVFNREIIVRDRIRFHHFKDGACSCMDYW 593 >ref|XP_002269101.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like [Vitis vinifera] Length = 607 Score = 92.8 bits (229), Expect = 4e-17 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = -3 Query: 301 KNLRVCGNCHSATKLISKIFNREIIARDRSRFHHFKDGSCSCMDYW 164 KNLRVC NCH TKLIS++FNREII RDR RFHHFKDG+CSCMDYW Sbjct: 562 KNLRVCNNCHQVTKLISRVFNREIIVRDRIRFHHFKDGACSCMDYW 607 >ref|XP_004975979.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Setaria italica] Length = 695 Score = 92.4 bits (228), Expect = 6e-17 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = -3 Query: 301 KNLRVCGNCHSATKLISKIFNREIIARDRSRFHHFKDGSCSCMDYW 164 KNLRVC +CHSATKLISK++NREI+ RDR+RFHHFKDGSCSC DYW Sbjct: 650 KNLRVCTDCHSATKLISKVYNREIVVRDRNRFHHFKDGSCSCNDYW 695 >ref|XP_003525660.2| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Glycine max] Length = 737 Score = 92.0 bits (227), Expect = 8e-17 Identities = 41/46 (89%), Positives = 42/46 (91%) Frame = -3 Query: 301 KNLRVCGNCHSATKLISKIFNREIIARDRSRFHHFKDGSCSCMDYW 164 KNLRVC NCHSATKLISKIFNREIIARDR+RFHHFKDG CSC D W Sbjct: 692 KNLRVCRNCHSATKLISKIFNREIIARDRNRFHHFKDGFCSCNDRW 737 >ref|XP_007203957.1| hypothetical protein PRUPE_ppa022872mg [Prunus persica] gi|462399488|gb|EMJ05156.1| hypothetical protein PRUPE_ppa022872mg [Prunus persica] Length = 714 Score = 91.3 bits (225), Expect = 1e-16 Identities = 40/46 (86%), Positives = 42/46 (91%) Frame = -3 Query: 301 KNLRVCGNCHSATKLISKIFNREIIARDRSRFHHFKDGSCSCMDYW 164 KNLRVC NCHSATKLISKIFNREIIARD +RFHHF+DGSCSC D W Sbjct: 669 KNLRVCANCHSATKLISKIFNREIIARDGNRFHHFRDGSCSCNDNW 714 >ref|XP_002448053.1| hypothetical protein SORBIDRAFT_06g020256 [Sorghum bicolor] gi|241939236|gb|EES12381.1| hypothetical protein SORBIDRAFT_06g020256 [Sorghum bicolor] Length = 693 Score = 91.3 bits (225), Expect = 1e-16 Identities = 37/46 (80%), Positives = 43/46 (93%) Frame = -3 Query: 301 KNLRVCGNCHSATKLISKIFNREIIARDRSRFHHFKDGSCSCMDYW 164 KNLRVC +CHSATKLISK++NREI+ RDR+RFHHFKDG+CSC DYW Sbjct: 648 KNLRVCTDCHSATKLISKVYNREIVVRDRNRFHHFKDGTCSCNDYW 693