BLASTX nr result
ID: Akebia25_contig00059194
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00059194 (261 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME42209.1| hypothetical protein DOTSEDRAFT_73133 [Dothistrom... 65 1e-08 gb|EON65438.1| hypothetical protein W97_04676 [Coniosporium apol... 64 2e-08 ref|XP_003851603.1| hypothetical protein MYCGRDRAFT_43161 [Zymos... 64 2e-08 ref|XP_003302762.1| hypothetical protein PTT_14698 [Pyrenophora ... 62 8e-08 gb|EMC95964.1| hypothetical protein BAUCODRAFT_71445, partial [B... 59 9e-07 gb|EUN25569.1| hypothetical protein COCVIDRAFT_103208 [Bipolaris... 58 2e-06 gb|EUC49531.1| hypothetical protein COCMIDRAFT_84465 [Bipolaris ... 58 2e-06 gb|EUC39155.1| hypothetical protein COCCADRAFT_81145 [Bipolaris ... 58 2e-06 gb|EOA85163.1| hypothetical protein SETTUDRAFT_163870 [Setosphae... 58 2e-06 gb|EMD66171.1| hypothetical protein COCSADRAFT_112299 [Bipolaris... 58 2e-06 gb|EMD94901.1| hypothetical protein COCHEDRAFT_1168256 [Bipolari... 56 5e-06 ref|XP_003845320.1| predicted protein [Leptosphaeria maculans JN... 56 6e-06 >gb|EME42209.1| hypothetical protein DOTSEDRAFT_73133 [Dothistroma septosporum NZE10] Length = 141 Score = 64.7 bits (156), Expect = 1e-08 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -2 Query: 260 WNQDIFLPSYLDYDSSDLERKPDPVQDIVLTDEE 159 WNQ++FLPSY DYDS DLE +PDPV+DI+LTDEE Sbjct: 101 WNQELFLPSYADYDSHDLEHRPDPVEDIILTDEE 134 >gb|EON65438.1| hypothetical protein W97_04676 [Coniosporium apollinis CBS 100218] Length = 134 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -2 Query: 260 WNQDIFLPSYLDYDSSDLERKPDPVQDIVLTDEE 159 WNQD+FLPSY+D+DS DLE K DP+QDIVLTDEE Sbjct: 94 WNQDLFLPSYIDHDSYDLEHKKDPIQDIVLTDEE 127 >ref|XP_003851603.1| hypothetical protein MYCGRDRAFT_43161 [Zymoseptoria tritici IPO323] gi|339471483|gb|EGP86579.1| hypothetical protein MYCGRDRAFT_43161 [Zymoseptoria tritici IPO323] Length = 76 Score = 63.9 bits (154), Expect = 2e-08 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = -2 Query: 260 WNQDIFLPSYLDYDSSDLERKPDPVQDIVLTDEE 159 WNQ++FLPSY DYDS+DLE +PDP+++IVLTDEE Sbjct: 36 WNQELFLPSYADYDSNDLEHRPDPIEEIVLTDEE 69 >ref|XP_003302762.1| hypothetical protein PTT_14698 [Pyrenophora teres f. teres 0-1] gi|311321693|gb|EFQ89157.1| hypothetical protein PTT_14698 [Pyrenophora teres f. teres 0-1] Length = 160 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -2 Query: 260 WNQDIFLPSYLDYDSSDLERKPDPVQDIVLTDEE 159 WNQ+IFLPSY DYD DLER+ DPVQDI+LT+EE Sbjct: 120 WNQEIFLPSYADYDFDDLERRQDPVQDIILTEEE 153 >gb|EMC95964.1| hypothetical protein BAUCODRAFT_71445, partial [Baudoinia compniacensis UAMH 10762] Length = 75 Score = 58.5 bits (140), Expect = 9e-07 Identities = 22/34 (64%), Positives = 30/34 (88%) Frame = -2 Query: 260 WNQDIFLPSYLDYDSSDLERKPDPVQDIVLTDEE 159 WNQ++FLPSY+ +D+ DLE +PDPV DI+LTDE+ Sbjct: 35 WNQELFLPSYVHFDAQDLEHRPDPVHDIILTDEQ 68 >gb|EUN25569.1| hypothetical protein COCVIDRAFT_103208 [Bipolaris victoriae FI3] Length = 161 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -2 Query: 260 WNQDIFLPSYLDYDSSDLERKPDPVQDIVLTDEE 159 WNQ+IFLPSY DY DLE + DPVQDI+LTDEE Sbjct: 121 WNQEIFLPSYADYHFDDLECRQDPVQDIILTDEE 154 >gb|EUC49531.1| hypothetical protein COCMIDRAFT_84465 [Bipolaris oryzae ATCC 44560] Length = 161 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -2 Query: 260 WNQDIFLPSYLDYDSSDLERKPDPVQDIVLTDEE 159 WNQ+IFLPSY DY DLE + DPVQDI+LTDEE Sbjct: 121 WNQEIFLPSYADYHFDDLECRQDPVQDIILTDEE 154 >gb|EUC39155.1| hypothetical protein COCCADRAFT_81145 [Bipolaris zeicola 26-R-13] Length = 161 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -2 Query: 260 WNQDIFLPSYLDYDSSDLERKPDPVQDIVLTDEE 159 WNQ+IFLPSY DY DLE + DPVQDI+LTDEE Sbjct: 121 WNQEIFLPSYADYHFDDLECRQDPVQDIILTDEE 154 >gb|EOA85163.1| hypothetical protein SETTUDRAFT_163870 [Setosphaeria turcica Et28A] Length = 163 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -2 Query: 260 WNQDIFLPSYLDYDSSDLERKPDPVQDIVLTDEE 159 WNQ+IFLPSY DY DLE + DPVQDI+LTDEE Sbjct: 123 WNQEIFLPSYADYHFDDLECRQDPVQDIILTDEE 156 >gb|EMD66171.1| hypothetical protein COCSADRAFT_112299 [Bipolaris sorokiniana ND90Pr] Length = 161 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -2 Query: 260 WNQDIFLPSYLDYDSSDLERKPDPVQDIVLTDEE 159 WNQ+IFLPSY DY DLE + DPVQDI+LTDEE Sbjct: 121 WNQEIFLPSYADYHFDDLECRQDPVQDIILTDEE 154 >gb|EMD94901.1| hypothetical protein COCHEDRAFT_1168256 [Bipolaris maydis C5] gi|477584717|gb|ENI01808.1| hypothetical protein COCC4DRAFT_26421 [Bipolaris maydis ATCC 48331] Length = 161 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -2 Query: 260 WNQDIFLPSYLDYDSSDLERKPDPVQDIVLTDEE 159 WNQ+IFLPSY DY DLE + DPVQDI+LT+EE Sbjct: 121 WNQEIFLPSYADYHFDDLECRQDPVQDIILTEEE 154 >ref|XP_003845320.1| predicted protein [Leptosphaeria maculans JN3] gi|312221901|emb|CBY01841.1| predicted protein [Leptosphaeria maculans JN3] Length = 156 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -2 Query: 260 WNQDIFLPSYLDYDSSDLERKPDPVQDIVLTDEE 159 WNQ+IFLPSY +Y DLE + DPV+DI+LTDEE Sbjct: 116 WNQEIFLPSYAEYHFDDLETRKDPVEDIILTDEE 149