BLASTX nr result
ID: Akebia25_contig00059064
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00059064 (215 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004513211.1| PREDICTED: pentatricopeptide repeat-containi... 108 6e-22 ref|XP_002511505.1| pentatricopeptide repeat-containing protein,... 106 3e-21 ref|XP_007210374.1| hypothetical protein PRUPE_ppa001256mg [Prun... 106 4e-21 ref|XP_006390391.1| hypothetical protein EUTSA_v10018113mg [Eutr... 105 6e-21 ref|XP_006300690.1| hypothetical protein CARUB_v10019733mg [Caps... 105 8e-21 ref|XP_006300689.1| hypothetical protein CARUB_v10019733mg [Caps... 105 8e-21 ref|XP_003527053.1| PREDICTED: pentatricopeptide repeat-containi... 105 8e-21 ref|XP_002887557.1| pentatricopeptide repeat-containing protein ... 105 8e-21 ref|XP_007157658.1| hypothetical protein PHAVU_002G087700g [Phas... 104 1e-20 ref|XP_007037187.1| Pentatricopeptide repeat-containing protein,... 104 1e-20 gb|EXC34220.1| hypothetical protein L484_010090 [Morus notabilis] 102 4e-20 ref|XP_003523047.2| PREDICTED: pentatricopeptide repeat-containi... 102 4e-20 ref|XP_006578589.1| PREDICTED: pentatricopeptide repeat-containi... 102 4e-20 ref|XP_006578590.1| PREDICTED: pentatricopeptide repeat-containi... 102 4e-20 ref|XP_002321537.1| pentatricopeptide repeat-containing family p... 102 5e-20 ref|XP_006476670.1| PREDICTED: pentatricopeptide repeat-containi... 102 7e-20 ref|XP_006439668.1| hypothetical protein CICLE_v10018829mg [Citr... 102 7e-20 ref|NP_177613.1| pentatricopeptide repeat-containing protein [Ar... 101 9e-20 ref|XP_004963337.1| PREDICTED: pentatricopeptide repeat-containi... 100 2e-19 ref|XP_004154991.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 100 2e-19 >ref|XP_004513211.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like [Cicer arietinum] Length = 879 Score = 108 bits (271), Expect = 6e-22 Identities = 49/58 (84%), Positives = 54/58 (93%) Frame = +1 Query: 1 RRSKVMGSSLVRQSVKELLNIFNFPFFTENGNSGCFVGCGKPLNTWLLHPYVERMHLL 174 RRS+V GSSLVRQSV ELL +F+FPFFTENGNSGCFVGCG+PL+ WLLHPYVERMHLL Sbjct: 822 RRSRVTGSSLVRQSVHELLRLFSFPFFTENGNSGCFVGCGEPLSQWLLHPYVERMHLL 879 >ref|XP_002511505.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550620|gb|EEF52107.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 876 Score = 106 bits (265), Expect = 3e-21 Identities = 47/58 (81%), Positives = 55/58 (94%) Frame = +1 Query: 1 RRSKVMGSSLVRQSVKELLNIFNFPFFTENGNSGCFVGCGKPLNTWLLHPYVERMHLL 174 RRS+V GSS+VRQ+V+ELL+IF+FPFFTENGNSGCFVGCG+PLN WLL PYV+RMHLL Sbjct: 819 RRSRVTGSSMVRQAVQELLHIFSFPFFTENGNSGCFVGCGEPLNRWLLQPYVDRMHLL 876 >ref|XP_007210374.1| hypothetical protein PRUPE_ppa001256mg [Prunus persica] gi|462406109|gb|EMJ11573.1| hypothetical protein PRUPE_ppa001256mg [Prunus persica] Length = 870 Score = 106 bits (264), Expect = 4e-21 Identities = 48/58 (82%), Positives = 54/58 (93%) Frame = +1 Query: 1 RRSKVMGSSLVRQSVKELLNIFNFPFFTENGNSGCFVGCGKPLNTWLLHPYVERMHLL 174 RRS+V GSSLVRQ+V+ELLN+F+FPFFTENGNSGCFVGCG+PLN WLL YVERMHLL Sbjct: 813 RRSRVTGSSLVRQAVEELLNMFSFPFFTENGNSGCFVGCGEPLNKWLLQSYVERMHLL 870 >ref|XP_006390391.1| hypothetical protein EUTSA_v10018113mg [Eutrema salsugineum] gi|557086825|gb|ESQ27677.1| hypothetical protein EUTSA_v10018113mg [Eutrema salsugineum] Length = 859 Score = 105 bits (262), Expect = 6e-21 Identities = 47/58 (81%), Positives = 53/58 (91%) Frame = +1 Query: 1 RRSKVMGSSLVRQSVKELLNIFNFPFFTENGNSGCFVGCGKPLNTWLLHPYVERMHLL 174 RRS+V G+S+VRQ+V+ELLNIFNFPFFTENGNSGCFVGCG+PL WLL YVERMHLL Sbjct: 802 RRSRVTGTSMVRQAVEELLNIFNFPFFTENGNSGCFVGCGEPLKNWLLESYVERMHLL 859 >ref|XP_006300690.1| hypothetical protein CARUB_v10019733mg [Capsella rubella] gi|482569400|gb|EOA33588.1| hypothetical protein CARUB_v10019733mg [Capsella rubella] Length = 853 Score = 105 bits (261), Expect = 8e-21 Identities = 47/58 (81%), Positives = 53/58 (91%) Frame = +1 Query: 1 RRSKVMGSSLVRQSVKELLNIFNFPFFTENGNSGCFVGCGKPLNTWLLHPYVERMHLL 174 RRS+V G+S+VRQ+V+ELLNIFNFPFFTENGNSGCFVGCG+PL WLL YVERMHLL Sbjct: 796 RRSRVTGTSMVRQAVEELLNIFNFPFFTENGNSGCFVGCGEPLKKWLLESYVERMHLL 853 >ref|XP_006300689.1| hypothetical protein CARUB_v10019733mg [Capsella rubella] gi|482569399|gb|EOA33587.1| hypothetical protein CARUB_v10019733mg [Capsella rubella] Length = 945 Score = 105 bits (261), Expect = 8e-21 Identities = 47/58 (81%), Positives = 53/58 (91%) Frame = +1 Query: 1 RRSKVMGSSLVRQSVKELLNIFNFPFFTENGNSGCFVGCGKPLNTWLLHPYVERMHLL 174 RRS+V G+S+VRQ+V+ELLNIFNFPFFTENGNSGCFVGCG+PL WLL YVERMHLL Sbjct: 888 RRSRVTGTSMVRQAVEELLNIFNFPFFTENGNSGCFVGCGEPLKKWLLESYVERMHLL 945 >ref|XP_003527053.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like [Glycine max] Length = 882 Score = 105 bits (261), Expect = 8e-21 Identities = 46/58 (79%), Positives = 55/58 (94%) Frame = +1 Query: 1 RRSKVMGSSLVRQSVKELLNIFNFPFFTENGNSGCFVGCGKPLNTWLLHPYVERMHLL 174 RRS+V GSSLVRQ+V+ELL++F+FPFFTENGNSGCFVGCG+PL+ WL+H YVERMHLL Sbjct: 825 RRSRVTGSSLVRQAVQELLHVFSFPFFTENGNSGCFVGCGEPLSQWLVHSYVERMHLL 882 >ref|XP_002887557.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297333398|gb|EFH63816.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 845 Score = 105 bits (261), Expect = 8e-21 Identities = 47/58 (81%), Positives = 53/58 (91%) Frame = +1 Query: 1 RRSKVMGSSLVRQSVKELLNIFNFPFFTENGNSGCFVGCGKPLNTWLLHPYVERMHLL 174 RRS+V G+S+VRQ+V+ELLNIFNFPFFTENGNSGCFVGCG+PL WLL YVERMHLL Sbjct: 788 RRSRVTGTSMVRQAVEELLNIFNFPFFTENGNSGCFVGCGEPLKKWLLESYVERMHLL 845 >ref|XP_007157658.1| hypothetical protein PHAVU_002G087700g [Phaseolus vulgaris] gi|561031073|gb|ESW29652.1| hypothetical protein PHAVU_002G087700g [Phaseolus vulgaris] Length = 881 Score = 104 bits (259), Expect = 1e-20 Identities = 47/58 (81%), Positives = 53/58 (91%) Frame = +1 Query: 1 RRSKVMGSSLVRQSVKELLNIFNFPFFTENGNSGCFVGCGKPLNTWLLHPYVERMHLL 174 RRS+V GSSLVRQ+V ELLN+F+FPFFTENGNSGCFVGCG+PL+ WL H YVERMHLL Sbjct: 824 RRSRVTGSSLVRQTVHELLNLFSFPFFTENGNSGCFVGCGEPLSQWLNHSYVERMHLL 881 >ref|XP_007037187.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] gi|508774432|gb|EOY21688.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 859 Score = 104 bits (259), Expect = 1e-20 Identities = 47/58 (81%), Positives = 54/58 (93%) Frame = +1 Query: 1 RRSKVMGSSLVRQSVKELLNIFNFPFFTENGNSGCFVGCGKPLNTWLLHPYVERMHLL 174 RRS+V GSSLVRQ+V++LL+IF+FPFFTENGNSGCFVGCG+PLN WLL YVERMHLL Sbjct: 802 RRSRVTGSSLVRQAVQDLLSIFSFPFFTENGNSGCFVGCGEPLNRWLLQSYVERMHLL 859 >gb|EXC34220.1| hypothetical protein L484_010090 [Morus notabilis] Length = 872 Score = 102 bits (255), Expect = 4e-20 Identities = 46/58 (79%), Positives = 53/58 (91%) Frame = +1 Query: 1 RRSKVMGSSLVRQSVKELLNIFNFPFFTENGNSGCFVGCGKPLNTWLLHPYVERMHLL 174 RRS+V G+SLVRQ+V+ELL +F+FPFFTENGNSGCFVGCG+PLN WLL YVERMHLL Sbjct: 815 RRSRVTGASLVRQAVQELLRMFSFPFFTENGNSGCFVGCGEPLNRWLLQSYVERMHLL 872 >ref|XP_003523047.2| PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like isoform X1 [Glycine max] Length = 882 Score = 102 bits (255), Expect = 4e-20 Identities = 45/58 (77%), Positives = 54/58 (93%) Frame = +1 Query: 1 RRSKVMGSSLVRQSVKELLNIFNFPFFTENGNSGCFVGCGKPLNTWLLHPYVERMHLL 174 RRS+V GSSLVRQ+V+ELL++F+FPFFTEN NSGCFVGCG+PL+ WL+H YVERMHLL Sbjct: 825 RRSRVTGSSLVRQAVQELLHVFSFPFFTENSNSGCFVGCGEPLSQWLVHSYVERMHLL 882 >ref|XP_006578589.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like isoform X2 [Glycine max] Length = 898 Score = 102 bits (255), Expect = 4e-20 Identities = 45/58 (77%), Positives = 54/58 (93%) Frame = +1 Query: 1 RRSKVMGSSLVRQSVKELLNIFNFPFFTENGNSGCFVGCGKPLNTWLLHPYVERMHLL 174 RRS+V GSSLVRQ+V+ELL++F+FPFFTEN NSGCFVGCG+PL+ WL+H YVERMHLL Sbjct: 841 RRSRVTGSSLVRQAVQELLHVFSFPFFTENSNSGCFVGCGEPLSQWLVHSYVERMHLL 898 >ref|XP_006578590.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like isoform X3 [Glycine max] Length = 879 Score = 102 bits (255), Expect = 4e-20 Identities = 45/58 (77%), Positives = 54/58 (93%) Frame = +1 Query: 1 RRSKVMGSSLVRQSVKELLNIFNFPFFTENGNSGCFVGCGKPLNTWLLHPYVERMHLL 174 RRS+V GSSLVRQ+V+ELL++F+FPFFTEN NSGCFVGCG+PL+ WL+H YVERMHLL Sbjct: 822 RRSRVTGSSLVRQAVQELLHVFSFPFFTENSNSGCFVGCGEPLSQWLVHSYVERMHLL 879 >ref|XP_002321537.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222868533|gb|EEF05664.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 834 Score = 102 bits (254), Expect = 5e-20 Identities = 46/58 (79%), Positives = 54/58 (93%) Frame = +1 Query: 1 RRSKVMGSSLVRQSVKELLNIFNFPFFTENGNSGCFVGCGKPLNTWLLHPYVERMHLL 174 RRS+V GSSLVRQ+V+ELL+IF+FPFFTENGN+GCFVGCG+PL+ WLL YVERMHLL Sbjct: 777 RRSRVTGSSLVRQAVQELLHIFSFPFFTENGNTGCFVGCGEPLSRWLLQSYVERMHLL 834 >ref|XP_006476670.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Citrus sinensis] Length = 856 Score = 102 bits (253), Expect = 7e-20 Identities = 45/58 (77%), Positives = 54/58 (93%) Frame = +1 Query: 1 RRSKVMGSSLVRQSVKELLNIFNFPFFTENGNSGCFVGCGKPLNTWLLHPYVERMHLL 174 RRS+V G+SLVRQ+V+ELL++F+FPFFTENGNSGCFVGCG+PLN WLL YV+RMHLL Sbjct: 799 RRSRVTGTSLVRQAVQELLHMFSFPFFTENGNSGCFVGCGEPLNKWLLQSYVDRMHLL 856 >ref|XP_006439668.1| hypothetical protein CICLE_v10018829mg [Citrus clementina] gi|557541930|gb|ESR52908.1| hypothetical protein CICLE_v10018829mg [Citrus clementina] Length = 856 Score = 102 bits (253), Expect = 7e-20 Identities = 45/58 (77%), Positives = 54/58 (93%) Frame = +1 Query: 1 RRSKVMGSSLVRQSVKELLNIFNFPFFTENGNSGCFVGCGKPLNTWLLHPYVERMHLL 174 RRS+V G+SLVRQ+V+ELL++F+FPFFTENGNSGCFVGCG+PLN WLL YV+RMHLL Sbjct: 799 RRSRVTGTSLVRQAVQELLHMFSFPFFTENGNSGCFVGCGEPLNKWLLQSYVDRMHLL 856 >ref|NP_177613.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75207514|sp|Q9SSF9.1|PP123_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g74750 gi|5882748|gb|AAD55301.1|AC008263_32 Contains 2 PF|01535 DUF domains [Arabidopsis thaliana] gi|332197508|gb|AEE35629.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 855 Score = 101 bits (252), Expect = 9e-20 Identities = 46/58 (79%), Positives = 52/58 (89%) Frame = +1 Query: 1 RRSKVMGSSLVRQSVKELLNIFNFPFFTENGNSGCFVGCGKPLNTWLLHPYVERMHLL 174 RRS+V G+S+VRQ+V+ELLNIFNFPFFTENGNSGCFVG G+PL WLL YVERMHLL Sbjct: 798 RRSRVTGTSMVRQAVEELLNIFNFPFFTENGNSGCFVGSGEPLKNWLLESYVERMHLL 855 >ref|XP_004963337.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like [Setaria italica] Length = 860 Score = 100 bits (250), Expect = 2e-19 Identities = 45/58 (77%), Positives = 52/58 (89%) Frame = +1 Query: 1 RRSKVMGSSLVRQSVKELLNIFNFPFFTENGNSGCFVGCGKPLNTWLLHPYVERMHLL 174 RRS+V GSSLVRQSV++LLN+F FPFFT GN+GCFVGCG+PLN WL +PYVERMHLL Sbjct: 803 RRSRVTGSSLVRQSVQKLLNLFEFPFFTTRGNTGCFVGCGEPLNKWLHNPYVERMHLL 860 >ref|XP_004154991.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g18900-like [Cucumis sativus] Length = 874 Score = 100 bits (250), Expect = 2e-19 Identities = 46/58 (79%), Positives = 53/58 (91%) Frame = +1 Query: 1 RRSKVMGSSLVRQSVKELLNIFNFPFFTENGNSGCFVGCGKPLNTWLLHPYVERMHLL 174 RRSKV GSSLVRQ+V++LL+IF+FPFFTENGNSGCFVGCG+PL+ WL YVERMHLL Sbjct: 817 RRSKVTGSSLVRQAVQDLLSIFSFPFFTENGNSGCFVGCGEPLSRWLHQSYVERMHLL 874