BLASTX nr result
ID: Akebia25_contig00058800
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00058800 (341 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC94382.1| hypothetical protein BAUCODRAFT_111219 [Baudoinia... 77 2e-12 ref|XP_003344330.1| hypothetical protein SMAC_08774 [Sordaria ma... 71 1e-10 gb|EGO54791.1| hypothetical protein NEUTE1DRAFT_132202 [Neurospo... 70 2e-10 ref|XP_956631.1| hypothetical protein NCU05133 [Neurospora crass... 70 2e-10 ref|XP_001903845.1| hypothetical protein [Podospora anserina S m... 69 9e-10 ref|XP_751423.1| UDP-glucose 4-epimerase [Aspergillus fumigatus ... 68 1e-09 gb|EDP50784.1| UDP-glucose 4-epimerase [Aspergillus fumigatus A1... 68 1e-09 gb|EON67193.1| UDP-glucose 4-epimerase [Coniosporium apollinis C... 68 2e-09 dbj|GAA84460.1| UDP-glucose 4-epimerase [Aspergillus kawachii IF... 65 7e-09 ref|XP_001400261.2| UDP-GAL-4-epimerase [Aspergillus niger CBS 5... 65 7e-09 emb|CAK44462.1| unnamed protein product [Aspergillus niger] 65 7e-09 ref|XP_001266635.1| udp-glucose 4-epimerase [Neosartorya fischer... 65 1e-08 ref|XP_001818409.1| UDP-GAL-4-epimerase [Aspergillus oryzae RIB4... 65 1e-08 ref|XP_003049147.1| hypothetical protein NECHADRAFT_16178 [Nectr... 65 1e-08 gb|EKD04960.1| hypothetical protein A1Q2_00760 [Trichosporon asa... 64 2e-08 gb|EJT52262.1| hypothetical protein A1Q1_05472 [Trichosporon asa... 64 2e-08 ref|XP_001263652.1| UDP-glucose 4-epimerase, putative [Neosartor... 64 2e-08 ref|XP_754823.1| UDP-glucose 4-epimerase [Aspergillus fumigatus ... 64 3e-08 ref|XP_001270806.1| UDP-glucose 4-epimerase, putative [Aspergill... 64 3e-08 gb|ERF71006.1| hypothetical protein EPUS_03285 [Endocarpon pusil... 62 8e-08 >gb|EMC94382.1| hypothetical protein BAUCODRAFT_111219 [Baudoinia compniacensis UAMH 10762] Length = 450 Score = 77.0 bits (188), Expect = 2e-12 Identities = 34/63 (53%), Positives = 44/63 (69%) Frame = +2 Query: 5 CMEAAADRTVPRTMAGRRAGDVGYCVAMTGRATAELGWSTKKSLTECAASLWNALKVSGQ 184 CME AA R++P GRR GDVG+CVA T RA EL W T+ SL +CAA W L++SG+ Sbjct: 388 CMEKAACRSIPVRRTGRRTGDVGFCVAATDRAMRELNWKTQLSLDDCAADTWRCLRLSGK 447 Query: 185 ISA 193 ++A Sbjct: 448 VAA 450 >ref|XP_003344330.1| hypothetical protein SMAC_08774 [Sordaria macrospora k-hell] gi|380087430|emb|CCC14262.1| unnamed protein product [Sordaria macrospora k-hell] Length = 462 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/52 (59%), Positives = 39/52 (75%) Frame = +2 Query: 8 MEAAADRTVPRTMAGRRAGDVGYCVAMTGRATAELGWSTKKSLTECAASLWN 163 +E AA R +P + RR GDVG CVA T RAT ELGW+T++S+T+CAA LWN Sbjct: 402 LEQAAGREIPLALVDRRPGDVGSCVASTDRATKELGWTTRESITKCAADLWN 453 >gb|EGO54791.1| hypothetical protein NEUTE1DRAFT_132202 [Neurospora tetrasperma FGSC 2508] gi|350286478|gb|EGZ67725.1| UDP-glucose 4-epimerase [Neurospora tetrasperma FGSC 2509] Length = 459 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/52 (59%), Positives = 38/52 (73%) Frame = +2 Query: 8 MEAAADRTVPRTMAGRRAGDVGYCVAMTGRATAELGWSTKKSLTECAASLWN 163 +E AA R +P + RR GDVG CVA T RA ELGWST++S+T+CAA LWN Sbjct: 399 LEQAAGREIPLALVDRRPGDVGMCVASTERAAKELGWSTRESITKCAADLWN 450 >ref|XP_956631.1| hypothetical protein NCU05133 [Neurospora crassa OR74A] gi|28881423|emb|CAD70540.1| hypothetical protein [Neurospora crassa] gi|28917703|gb|EAA27395.1| udp-glucose 4-epimerase [Neurospora crassa OR74A] Length = 459 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/52 (59%), Positives = 38/52 (73%) Frame = +2 Query: 8 MEAAADRTVPRTMAGRRAGDVGYCVAMTGRATAELGWSTKKSLTECAASLWN 163 +E AA R +P + RR GDVG CVA T RA ELGWST++S+T+CAA LWN Sbjct: 399 LEQAAGREIPLALVDRRPGDVGMCVASTERAAKELGWSTRESITKCAADLWN 450 >ref|XP_001903845.1| hypothetical protein [Podospora anserina S mat+] gi|170936962|emb|CAP61621.1| unnamed protein product [Podospora anserina S mat+] Length = 471 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/52 (59%), Positives = 39/52 (75%) Frame = +2 Query: 8 MEAAADRTVPRTMAGRRAGDVGYCVAMTGRATAELGWSTKKSLTECAASLWN 163 +EAA+ RTV AGRR GDVG CVA T RA+ ELGWS ++S+ +CA+ LWN Sbjct: 403 LEAASKRTVSLDWAGRRPGDVGVCVASTERASKELGWSPRESVAQCASDLWN 454 >ref|XP_751423.1| UDP-glucose 4-epimerase [Aspergillus fumigatus Af293] gi|66095559|gb|AAY42822.1| UDP-GAL-4-epimerase [Aspergillus fumigatus] gi|66849057|gb|EAL89385.1| UDP-glucose 4-epimerase [Aspergillus fumigatus Af293] Length = 415 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/57 (52%), Positives = 38/57 (66%) Frame = +2 Query: 2 ECMEAAADRTVPRTMAGRRAGDVGYCVAMTGRATAELGWSTKKSLTECAASLWNALK 172 + +E + RT+PR + GRRAGD+G CVA RA AELGW+T KSLT LW L+ Sbjct: 358 QTLETVSGRTIPRRVVGRRAGDIGSCVASAERAAAELGWTTAKSLTNACEDLWGYLQ 414 >gb|EDP50784.1| UDP-glucose 4-epimerase [Aspergillus fumigatus A1163] Length = 415 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/57 (52%), Positives = 38/57 (66%) Frame = +2 Query: 2 ECMEAAADRTVPRTMAGRRAGDVGYCVAMTGRATAELGWSTKKSLTECAASLWNALK 172 + +E + RT+PR + GRRAGD+G CVA RA AELGW+T KSLT LW L+ Sbjct: 358 QTLETVSGRTIPRRVVGRRAGDIGSCVASAERAAAELGWTTAKSLTNACEDLWGYLQ 414 >gb|EON67193.1| UDP-glucose 4-epimerase [Coniosporium apollinis CBS 100218] Length = 422 Score = 67.8 bits (164), Expect = 2e-09 Identities = 29/52 (55%), Positives = 37/52 (71%) Frame = +2 Query: 8 MEAAADRTVPRTMAGRRAGDVGYCVAMTGRATAELGWSTKKSLTECAASLWN 163 +E A+ R++P GRRAGDVG+CVA RA ELGW T+KSL +CA +WN Sbjct: 360 IEKASARSIPAREVGRRAGDVGFCVAAVDRAETELGWRTQKSLQDCATDVWN 411 >dbj|GAA84460.1| UDP-glucose 4-epimerase [Aspergillus kawachii IFO 4308] Length = 428 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/58 (55%), Positives = 39/58 (67%) Frame = +2 Query: 8 MEAAADRTVPRTMAGRRAGDVGYCVAMTGRATAELGWSTKKSLTECAASLWNALKVSG 181 MEA + + +PR AGRRAGDVG CVA+ R+ EL W T+KSL + SL N L VSG Sbjct: 368 MEAVSSKPIPRKAAGRRAGDVGSCVAVATRSQDELEWKTEKSLKDACVSLCNFLNVSG 425 >ref|XP_001400261.2| UDP-GAL-4-epimerase [Aspergillus niger CBS 513.88] gi|350635017|gb|EHA23379.1| UDP-glucose 4-epimerase [Aspergillus niger ATCC 1015] Length = 428 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/58 (55%), Positives = 39/58 (67%) Frame = +2 Query: 8 MEAAADRTVPRTMAGRRAGDVGYCVAMTGRATAELGWSTKKSLTECAASLWNALKVSG 181 MEA + + +PR AGRRAGDVG CVA+ R+ EL W T+KSL + SL N L VSG Sbjct: 368 MEAVSSKPIPRKAAGRRAGDVGSCVAVATRSQDELEWKTEKSLKDACVSLCNFLNVSG 425 >emb|CAK44462.1| unnamed protein product [Aspergillus niger] Length = 413 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/58 (55%), Positives = 39/58 (67%) Frame = +2 Query: 8 MEAAADRTVPRTMAGRRAGDVGYCVAMTGRATAELGWSTKKSLTECAASLWNALKVSG 181 MEA + + +PR AGRRAGDVG CVA+ R+ EL W T+KSL + SL N L VSG Sbjct: 353 MEAVSSKPIPRKAAGRRAGDVGSCVAVATRSQDELEWKTEKSLKDACVSLCNFLNVSG 410 >ref|XP_001266635.1| udp-glucose 4-epimerase [Neosartorya fischeri NRRL 181] gi|119414800|gb|EAW24738.1| udp-glucose 4-epimerase [Neosartorya fischeri NRRL 181] Length = 414 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/55 (52%), Positives = 37/55 (67%) Frame = +2 Query: 8 MEAAADRTVPRTMAGRRAGDVGYCVAMTGRATAELGWSTKKSLTECAASLWNALK 172 +E + RT+PR + GRRAGDVG CVA RA ELGW+T+KSL + LW L+ Sbjct: 359 LENVSGRTIPRRVVGRRAGDVGSCVASAERAAVELGWTTEKSLRDACEDLWGYLQ 413 >ref|XP_001818409.1| UDP-GAL-4-epimerase [Aspergillus oryzae RIB40] gi|83766264|dbj|BAE56407.1| unnamed protein product [Aspergillus oryzae RIB40] gi|391870564|gb|EIT79744.1| UDP-glucose 4-epimerase [Aspergillus oryzae 3.042] Length = 428 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/58 (53%), Positives = 40/58 (68%) Frame = +2 Query: 8 MEAAADRTVPRTMAGRRAGDVGYCVAMTGRATAELGWSTKKSLTECAASLWNALKVSG 181 ME+ + + +PR A RRAGDVG CVA+ R+ EL W T+K+LT+ ASL N L VSG Sbjct: 368 MESVSSKAIPRRAADRRAGDVGSCVAVATRSQEELQWKTEKTLTDACASLCNFLAVSG 425 >ref|XP_003049147.1| hypothetical protein NECHADRAFT_16178 [Nectria haematococca mpVI 77-13-4] gi|256730082|gb|EEU43434.1| hypothetical protein NECHADRAFT_16178 [Nectria haematococca mpVI 77-13-4] Length = 380 Score = 64.7 bits (156), Expect = 1e-08 Identities = 26/54 (48%), Positives = 39/54 (72%) Frame = +2 Query: 2 ECMEAAADRTVPRTMAGRRAGDVGYCVAMTGRATAELGWSTKKSLTECAASLWN 163 + +EAA+ R +P +A RR GDVG+CVA RA +EL W+ ++S+ +CA+ LWN Sbjct: 322 QSLEAASSRRIPVKLAPRRGGDVGFCVAANDRAASELNWTAQESIQQCASDLWN 375 >gb|EKD04960.1| hypothetical protein A1Q2_00760 [Trichosporon asahii var. asahii CBS 8904] Length = 397 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/53 (54%), Positives = 37/53 (69%) Frame = +2 Query: 2 ECMEAAADRTVPRTMAGRRAGDVGYCVAMTGRATAELGWSTKKSLTECAASLW 160 + +EAA+ R +P +A RR GDVG CVA RATAELGW+T +SL + A LW Sbjct: 336 DALEAASGRKIPAVLAPRREGDVGSCVAANARATAELGWTTTESLLQSARDLW 388 >gb|EJT52262.1| hypothetical protein A1Q1_05472 [Trichosporon asahii var. asahii CBS 2479] Length = 397 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/53 (54%), Positives = 37/53 (69%) Frame = +2 Query: 2 ECMEAAADRTVPRTMAGRRAGDVGYCVAMTGRATAELGWSTKKSLTECAASLW 160 + +EAA+ R +P +A RR GDVG CVA RATAELGW+T +SL + A LW Sbjct: 336 DALEAASGRKIPAVLAPRREGDVGSCVAANARATAELGWTTTESLLQSARDLW 388 >ref|XP_001263652.1| UDP-glucose 4-epimerase, putative [Neosartorya fischeri NRRL 181] gi|119411812|gb|EAW21755.1| UDP-glucose 4-epimerase, putative [Neosartorya fischeri NRRL 181] Length = 428 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/60 (53%), Positives = 39/60 (65%) Frame = +2 Query: 2 ECMEAAADRTVPRTMAGRRAGDVGYCVAMTGRATAELGWSTKKSLTECAASLWNALKVSG 181 E ME + R +PR A RRAGDVG CVA+ R+ EL W T+KSL + SL N L+VSG Sbjct: 366 ETMEDVSSRHIPRRAADRRAGDVGSCVAVATRSQQELNWKTEKSLKDACVSLCNFLEVSG 425 >ref|XP_754823.1| UDP-glucose 4-epimerase [Aspergillus fumigatus Af293] gi|66095588|gb|AAY42823.1| UDP-GAL-4-epimerase [Aspergillus fumigatus] gi|66852460|gb|EAL92785.1| UDP-glucose 4-epimerase, putative [Aspergillus fumigatus Af293] gi|159127834|gb|EDP52949.1| UDP-glucose 4-epimerase, putative [Aspergillus fumigatus A1163] Length = 428 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/60 (51%), Positives = 39/60 (65%) Frame = +2 Query: 2 ECMEAAADRTVPRTMAGRRAGDVGYCVAMTGRATAELGWSTKKSLTECAASLWNALKVSG 181 E ME + + +PR A RRAGDVG CVA+ R+ EL W T+KSL + SL N L+VSG Sbjct: 366 ETMEEVSSKHIPRRAADRRAGDVGSCVAVATRSQQELNWKTEKSLKDACVSLCNFLEVSG 425 >ref|XP_001270806.1| UDP-glucose 4-epimerase, putative [Aspergillus clavatus NRRL 1] gi|119398952|gb|EAW09380.1| UDP-glucose 4-epimerase, putative [Aspergillus clavatus NRRL 1] Length = 428 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/60 (50%), Positives = 39/60 (65%) Frame = +2 Query: 2 ECMEAAADRTVPRTMAGRRAGDVGYCVAMTGRATAELGWSTKKSLTECAASLWNALKVSG 181 E ME + + +PR A RRAGDVG CVA+ R+ EL W T+KSL + +L N L+VSG Sbjct: 366 ETMEGVSSKHIPRRAADRRAGDVGSCVAVAARSQEELNWQTEKSLEDACVNLCNFLEVSG 425 >gb|ERF71006.1| hypothetical protein EPUS_03285 [Endocarpon pusillum Z07020] Length = 445 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/58 (48%), Positives = 37/58 (63%) Frame = +2 Query: 2 ECMEAAADRTVPRTMAGRRAGDVGYCVAMTGRATAELGWSTKKSLTECAASLWNALKV 175 E ME + + +PR GRRAGDVG CVAM GR+ EL W T+K+L + + N L+V Sbjct: 368 EAMETVSQKPIPRKAVGRRAGDVGSCVAMAGRSQEELQWKTEKTLRDACEDIVNFLRV 425