BLASTX nr result
ID: Akebia25_contig00058756
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00058756 (456 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006848591.1| hypothetical protein AMTR_s00168p00052130 [A... 56 5e-06 >ref|XP_006848591.1| hypothetical protein AMTR_s00168p00052130 [Amborella trichopoda] gi|548851913|gb|ERN10172.1| hypothetical protein AMTR_s00168p00052130 [Amborella trichopoda] Length = 183 Score = 56.2 bits (134), Expect = 5e-06 Identities = 36/83 (43%), Positives = 40/83 (48%) Frame = -3 Query: 250 FDCSSLPSTMDRFQLHPPYLNTNSHLSQNIDDFLLTSXXXXNISTHKENKDDYKTYXXXX 71 FD L + M R QL PPYLN NS LSQN+DDFLL + DD KT Sbjct: 13 FDNLLLRTLMGRLQLRPPYLNNNSFLSQNLDDFLLEA---------TTEDDDEKTPLAKE 63 Query: 70 XXXXXXXXIRTILSGKIETLKPN 2 +R I G ETLKPN Sbjct: 64 ELKLEREIVRLIHMGNTETLKPN 86