BLASTX nr result
ID: Akebia25_contig00058731
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00058731 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513597.1| Ethylene-responsive transcription factor, pu... 56 6e-06 >ref|XP_002513597.1| Ethylene-responsive transcription factor, putative [Ricinus communis] gi|223547505|gb|EEF49000.1| Ethylene-responsive transcription factor, putative [Ricinus communis] Length = 309 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/60 (46%), Positives = 36/60 (60%) Frame = -3 Query: 205 EEKSKPEINLTNLSGYNPAEESHNLSSPTSVFQFNCSSRGLQNLQKPVEGAREEEDQDKT 26 +E+ KP+ N+T+ SGY +ESHNLSSPTSV F S G QKP +E DK+ Sbjct: 197 QEQEKPDTNVTSTSGYESGDESHNLSSPTSVLNFQAHSIGESESQKP----ESQEPDDKS 252