BLASTX nr result
ID: Akebia25_contig00058691
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00058691 (333 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003297268.1| hypothetical protein PTT_07606 [Pyrenophora ... 56 6e-06 >ref|XP_003297268.1| hypothetical protein PTT_07606 [Pyrenophora teres f. teres 0-1] gi|311330167|gb|EFQ94643.1| hypothetical protein PTT_07606 [Pyrenophora teres f. teres 0-1] Length = 623 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/66 (45%), Positives = 40/66 (60%), Gaps = 1/66 (1%) Frame = +3 Query: 138 NGSKKKRKPDNLKPIITSDRK-SQNPSRASSVNSVNYTVQAGNVQAAQNPSYAKNIDRSP 314 NG KK+RK +LKPIITS+ + QN S + S S +Y VQ+ N AQ+ Y + SP Sbjct: 24 NGGKKRRKGQDLKPIITSENQGGQNTSPSGSTPSFHYNVQSTNSPLAQHKMYGNQMSHSP 83 Query: 315 SADSSS 332 + SSS Sbjct: 84 DSSSSS 89