BLASTX nr result
ID: Akebia25_contig00058672
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00058672 (593 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001266220.1| exonuclease Kem1, putative [Neosartorya fisc... 58 2e-06 >ref|XP_001266220.1| exonuclease Kem1, putative [Neosartorya fischeri NRRL 181] gi|119414384|gb|EAW24323.1| exonuclease Kem1, putative [Neosartorya fischeri NRRL 181] Length = 1414 Score = 58.2 bits (139), Expect = 2e-06 Identities = 31/60 (51%), Positives = 38/60 (63%), Gaps = 4/60 (6%) Frame = +2 Query: 5 SSARQPAAHTPQPFAARGYG---GANGIDRSVPAAAPPPLTGSFRGAISG-ANSRGNFAP 172 ++A Q A P P GYG G NG+ + AAAPPPLT S+RGA+SG N+RGN AP Sbjct: 1235 AAASQQAQSQPSPLTVAGYGAPLGPNGLGQLKEAAAPPPLTNSYRGAVSGLGNTRGNGAP 1294