BLASTX nr result
ID: Akebia25_contig00058625
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00058625 (382 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006376939.1| hypothetical protein POPTR_0012s11360g [Popu... 96 4e-18 ref|XP_007038198.1| Tetratricopeptide repeat-like superfamily pr... 92 1e-16 ref|XP_006485046.1| PREDICTED: pentatricopeptide repeat-containi... 91 1e-16 ref|XP_006437011.1| hypothetical protein CICLE_v10033882mg [Citr... 91 1e-16 ref|XP_004975979.1| PREDICTED: pentatricopeptide repeat-containi... 88 1e-15 ref|XP_004958455.1| PREDICTED: pentatricopeptide repeat-containi... 88 1e-15 emb|CAJ19324.1| selenium binding protein [Triticum aestivum] 87 2e-15 ref|XP_006655943.1| PREDICTED: pentatricopeptide repeat-containi... 87 2e-15 ref|XP_007035985.1| Tetratricopeptide repeat-like superfamily pr... 87 2e-15 emb|CBI29768.3| unnamed protein product [Vitis vinifera] 87 2e-15 emb|CBI14948.3| unnamed protein product [Vitis vinifera] 87 2e-15 ref|XP_002448053.1| hypothetical protein SORBIDRAFT_06g020256 [S... 87 2e-15 ref|XP_002266190.1| PREDICTED: pentatricopeptide repeat-containi... 87 2e-15 ref|XP_002277458.1| PREDICTED: pentatricopeptide repeat-containi... 87 2e-15 ref|XP_002324235.2| pentatricopeptide repeat-containing family p... 87 3e-15 ref|XP_007208802.1| hypothetical protein PRUPE_ppa024573mg [Prun... 87 3e-15 ref|XP_004231338.1| PREDICTED: pentatricopeptide repeat-containi... 87 3e-15 dbj|BAJ96548.1| predicted protein [Hordeum vulgare subsp. vulgare] 87 3e-15 gb|EXB38456.1| hypothetical protein L484_022357 [Morus notabilis] 86 4e-15 gb|EEE51036.1| hypothetical protein OsJ_31684 [Oryza sativa Japo... 86 4e-15 >ref|XP_006376939.1| hypothetical protein POPTR_0012s11360g [Populus trichocarpa] gi|550326873|gb|ERP54736.1| hypothetical protein POPTR_0012s11360g [Populus trichocarpa] Length = 648 Score = 96.3 bits (238), Expect = 4e-18 Identities = 39/47 (82%), Positives = 44/47 (93%) Frame = -2 Query: 381 TKNLRVCNDCHSAFKLISNVFNRKIVVRDANRFHHFQSGSCSCKDYW 241 TKNLRVCNDCHSAFK IS+++ RKI+VRDANRFHHFQ G+CSCKDYW Sbjct: 602 TKNLRVCNDCHSAFKYISHIYQRKIIVRDANRFHHFQGGTCSCKDYW 648 >ref|XP_007038198.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] gi|508775443|gb|EOY22699.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] Length = 753 Score = 91.7 bits (226), Expect = 1e-16 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = -2 Query: 381 TKNLRVCNDCHSAFKLISNVFNRKIVVRDANRFHHFQSGSCSCKDYW 241 TKNLR+C+DCHSAFK +S V+ RKIVVRDANRFHHFQ G+CSC DYW Sbjct: 707 TKNLRICSDCHSAFKFVSYVYGRKIVVRDANRFHHFQDGTCSCNDYW 753 >ref|XP_006485046.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Citrus sinensis] Length = 685 Score = 91.3 bits (225), Expect = 1e-16 Identities = 36/47 (76%), Positives = 42/47 (89%) Frame = -2 Query: 381 TKNLRVCNDCHSAFKLISNVFNRKIVVRDANRFHHFQSGSCSCKDYW 241 TKNLRVCNDCHSAF+ IS ++ RKI+VRDANRFHHF+ G+CSC DYW Sbjct: 639 TKNLRVCNDCHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 685 >ref|XP_006437011.1| hypothetical protein CICLE_v10033882mg [Citrus clementina] gi|557539207|gb|ESR50251.1| hypothetical protein CICLE_v10033882mg [Citrus clementina] Length = 685 Score = 91.3 bits (225), Expect = 1e-16 Identities = 36/47 (76%), Positives = 42/47 (89%) Frame = -2 Query: 381 TKNLRVCNDCHSAFKLISNVFNRKIVVRDANRFHHFQSGSCSCKDYW 241 TKNLRVCNDCHSAF+ IS ++ RKI+VRDANRFHHF+ G+CSC DYW Sbjct: 639 TKNLRVCNDCHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 685 >ref|XP_004975979.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Setaria italica] Length = 695 Score = 88.2 bits (217), Expect = 1e-15 Identities = 37/47 (78%), Positives = 41/47 (87%) Frame = -2 Query: 381 TKNLRVCNDCHSAFKLISNVFNRKIVVRDANRFHHFQSGSCSCKDYW 241 +KNLRVC DCHSA KLIS V+NR+IVVRD NRFHHF+ GSCSC DYW Sbjct: 649 SKNLRVCTDCHSATKLISKVYNREIVVRDRNRFHHFKDGSCSCNDYW 695 >ref|XP_004958455.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like [Setaria italica] Length = 444 Score = 87.8 bits (216), Expect = 1e-15 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = -2 Query: 381 TKNLRVCNDCHSAFKLISNVFNRKIVVRDANRFHHFQSGSCSCKDYW 241 TKNLR C DCHSA KLIS V+NRK+++RD NRFHHF G CSCKDYW Sbjct: 398 TKNLRACEDCHSAIKLISLVYNRKLIIRDRNRFHHFSEGQCSCKDYW 444 >emb|CAJ19324.1| selenium binding protein [Triticum aestivum] Length = 624 Score = 87.4 bits (215), Expect = 2e-15 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = -2 Query: 378 KNLRVCNDCHSAFKLISNVFNRKIVVRDANRFHHFQSGSCSCKDYW 241 KN+R+C DCHSAFK IS VF R+IVVRD NRFHHF SGSCSC DYW Sbjct: 579 KNIRICGDCHSAFKYISKVFGREIVVRDTNRFHHFSSGSCSCGDYW 624 >ref|XP_006655943.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like [Oryza brachyantha] Length = 598 Score = 87.0 bits (214), Expect = 2e-15 Identities = 35/47 (74%), Positives = 41/47 (87%) Frame = -2 Query: 381 TKNLRVCNDCHSAFKLISNVFNRKIVVRDANRFHHFQSGSCSCKDYW 241 TKNLRVC DCH A K++S VF+R+IVVRD NRFHHF+ G+CSCKDYW Sbjct: 552 TKNLRVCRDCHEATKIVSRVFDREIVVRDRNRFHHFKDGTCSCKDYW 598 >ref|XP_007035985.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] gi|508715014|gb|EOY06911.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] Length = 628 Score = 87.0 bits (214), Expect = 2e-15 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = -2 Query: 381 TKNLRVCNDCHSAFKLISNVFNRKIVVRDANRFHHFQSGSCSCKDYW 241 TKNLRVC DCH A KLIS VF+R+I+VRD NRFHHF+ G CSCKDYW Sbjct: 582 TKNLRVCRDCHHASKLISKVFDREIIVRDRNRFHHFKDGECSCKDYW 628 >emb|CBI29768.3| unnamed protein product [Vitis vinifera] Length = 676 Score = 87.0 bits (214), Expect = 2e-15 Identities = 35/47 (74%), Positives = 40/47 (85%) Frame = -2 Query: 381 TKNLRVCNDCHSAFKLISNVFNRKIVVRDANRFHHFQSGSCSCKDYW 241 TKNLRVC+DCH AFK IS+++ RKI+VRD NRFHHFQ G CSC DYW Sbjct: 630 TKNLRVCSDCHWAFKFISSIYGRKIIVRDGNRFHHFQGGRCSCGDYW 676 >emb|CBI14948.3| unnamed protein product [Vitis vinifera] Length = 401 Score = 87.0 bits (214), Expect = 2e-15 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = -2 Query: 381 TKNLRVCNDCHSAFKLISNVFNRKIVVRDANRFHHFQSGSCSCKDYW 241 TKNLRVC DCH+A KL+S VFNR+IVVRD RFHHF+ GSCSC DYW Sbjct: 355 TKNLRVCTDCHNATKLVSKVFNREIVVRDRTRFHHFKEGSCSCNDYW 401 >ref|XP_002448053.1| hypothetical protein SORBIDRAFT_06g020256 [Sorghum bicolor] gi|241939236|gb|EES12381.1| hypothetical protein SORBIDRAFT_06g020256 [Sorghum bicolor] Length = 693 Score = 87.0 bits (214), Expect = 2e-15 Identities = 36/47 (76%), Positives = 41/47 (87%) Frame = -2 Query: 381 TKNLRVCNDCHSAFKLISNVFNRKIVVRDANRFHHFQSGSCSCKDYW 241 +KNLRVC DCHSA KLIS V+NR+IVVRD NRFHHF+ G+CSC DYW Sbjct: 647 SKNLRVCTDCHSATKLISKVYNREIVVRDRNRFHHFKDGTCSCNDYW 693 >ref|XP_002266190.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 [Vitis vinifera] Length = 707 Score = 87.0 bits (214), Expect = 2e-15 Identities = 35/47 (74%), Positives = 40/47 (85%) Frame = -2 Query: 381 TKNLRVCNDCHSAFKLISNVFNRKIVVRDANRFHHFQSGSCSCKDYW 241 TKNLRVC+DCH AFK IS+++ RKI+VRD NRFHHFQ G CSC DYW Sbjct: 661 TKNLRVCSDCHWAFKFISSIYGRKIIVRDGNRFHHFQGGRCSCGDYW 707 >ref|XP_002277458.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070 [Vitis vinifera] Length = 698 Score = 87.0 bits (214), Expect = 2e-15 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = -2 Query: 381 TKNLRVCNDCHSAFKLISNVFNRKIVVRDANRFHHFQSGSCSCKDYW 241 TKNLRVC DCH+A KL+S VFNR+IVVRD RFHHF+ GSCSC DYW Sbjct: 652 TKNLRVCTDCHNATKLVSKVFNREIVVRDRTRFHHFKEGSCSCNDYW 698 >ref|XP_002324235.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550317719|gb|EEF02800.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 736 Score = 86.7 bits (213), Expect = 3e-15 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -2 Query: 378 KNLRVCNDCHSAFKLISNVFNRKIVVRDANRFHHFQSGSCSCKDYW 241 KNLRVC +CHSA KLIS +FNR+I+ RD NRFHHF+ GSCSCKDYW Sbjct: 691 KNLRVCGNCHSATKLISKIFNREIIARDRNRFHHFKDGSCSCKDYW 736 >ref|XP_007208802.1| hypothetical protein PRUPE_ppa024573mg [Prunus persica] gi|462404537|gb|EMJ10001.1| hypothetical protein PRUPE_ppa024573mg [Prunus persica] Length = 699 Score = 86.7 bits (213), Expect = 3e-15 Identities = 36/47 (76%), Positives = 41/47 (87%) Frame = -2 Query: 381 TKNLRVCNDCHSAFKLISNVFNRKIVVRDANRFHHFQSGSCSCKDYW 241 +KNLRVC DCH+A K+IS VFNR+IVVRD NRFHHF+ GSCSC DYW Sbjct: 653 SKNLRVCTDCHNATKMISKVFNRQIVVRDWNRFHHFKEGSCSCNDYW 699 >ref|XP_004231338.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Solanum lycopersicum] Length = 625 Score = 86.7 bits (213), Expect = 3e-15 Identities = 32/47 (68%), Positives = 41/47 (87%) Frame = -2 Query: 381 TKNLRVCNDCHSAFKLISNVFNRKIVVRDANRFHHFQSGSCSCKDYW 241 TKNLR+C DCH+A KL+S ++ R+I+VRD NRFHHF+ GSCSC+DYW Sbjct: 579 TKNLRICGDCHTAIKLVSKIYEREIIVRDVNRFHHFKDGSCSCRDYW 625 >dbj|BAJ96548.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 624 Score = 86.7 bits (213), Expect = 3e-15 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -2 Query: 378 KNLRVCNDCHSAFKLISNVFNRKIVVRDANRFHHFQSGSCSCKDYW 241 KN+R+C DCHSAFK IS VF R+IVVRD NRFHHF +GSCSC DYW Sbjct: 579 KNIRICGDCHSAFKYISKVFGREIVVRDTNRFHHFSNGSCSCADYW 624 >gb|EXB38456.1| hypothetical protein L484_022357 [Morus notabilis] Length = 651 Score = 86.3 bits (212), Expect = 4e-15 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = -2 Query: 378 KNLRVCNDCHSAFKLISNVFNRKIVVRDANRFHHFQSGSCSCKDYW 241 KNLRVC DCHS KL+S V+NR+IV+RD NRFHHF++G CSCKDYW Sbjct: 606 KNLRVCRDCHSFMKLVSRVYNRRIVIRDQNRFHHFENGFCSCKDYW 651 >gb|EEE51036.1| hypothetical protein OsJ_31684 [Oryza sativa Japonica Group] Length = 637 Score = 86.3 bits (212), Expect = 4e-15 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -2 Query: 378 KNLRVCNDCHSAFKLISNVFNRKIVVRDANRFHHFQSGSCSCKDYW 241 KN+R+C DCHSAF+ IS VF R+IVVRD NRFHHF SGSCSC DYW Sbjct: 592 KNIRICGDCHSAFRYISKVFKREIVVRDTNRFHHFSSGSCSCGDYW 637