BLASTX nr result
ID: Akebia25_contig00058624
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00058624 (553 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_358634.1| hypothetical protein PhapfoPp088 [Phalaenopsis ... 68 5e-11 >ref|YP_358634.1| hypothetical protein PhapfoPp088 [Phalaenopsis aphrodite subsp. formosana] gi|58802850|gb|AAW82570.1| hypothetical protein [Phalaenopsis aphrodite subsp. formosana] Length = 86 Score = 68.2 bits (165), Expect(2) = 5e-11 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -3 Query: 488 LIPSIISS*AWSYFTIEKRKKTSISKLSSDVARFFLGVK 372 L P IISS AWSYFT+EKRKKTSISKL+SDVARFFLGVK Sbjct: 36 LRPRIISSWAWSYFTVEKRKKTSISKLNSDVARFFLGVK 74 Score = 25.0 bits (53), Expect(2) = 5e-11 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 534 MPKTRKTPSLSF 499 MPK R+TPSLSF Sbjct: 1 MPKARETPSLSF 12