BLASTX nr result
ID: Akebia25_contig00058556
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00058556 (243 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXJ92049.1| 60S ribosomal protein L23 [Capronia epimyces CBS ... 87 2e-15 ref|XP_001221309.1| 60S ribosomal protein L23 [Chaetomium globos... 87 2e-15 ref|XP_380978.1| hypothetical protein FG00802.1 [Fusarium gramin... 87 2e-15 gb|ETS75063.1| 60S ribosomal protein L23-B [Pestalotiopsis fici ... 87 2e-15 gb|ETN41674.1| 60S ribosomal protein L23 [Cyphellophora europaea... 87 2e-15 gb|ETI20689.1| 60S ribosomal protein L23 [Cladophialophora carri... 87 2e-15 gb|ERS94890.1| 60S ribosomal protein L23 [Sporothrix schenckii A... 87 2e-15 gb|ERF75540.1| 60S ribosomal protein L23-B [Endocarpon pusillum ... 87 2e-15 gb|EPQ63865.1| Protein component of the large (60S) ribosomal su... 87 2e-15 gb|EPE24736.1| Ribosomal protein L14 [Glarea lozoyensis ATCC 20868] 87 2e-15 gb|EPE09785.1| 60s ribosomal protein l23 [Ophiostoma piceae UAMH... 87 2e-15 gb|EON67249.1| 60S ribosomal protein L23 [Coniosporium apollinis... 87 2e-15 gb|ENH84580.1| 60s ribosomal protein l23 [Colletotrichum orbicul... 87 2e-15 gb|EMR63316.1| putative 60s ribosomal protein l23 protein [Eutyp... 87 2e-15 gb|EME83489.1| hypothetical protein MYCFIDRAFT_52202 [Pseudocerc... 87 2e-15 gb|EME46170.1| hypothetical protein DOTSEDRAFT_70233 [Dothistrom... 87 2e-15 gb|AAO65478.4| alkaline serine protease [Clonostachys rosea] 87 2e-15 ref|XP_003712412.1| 60S ribosomal protein L23 [Magnaporthe oryza... 87 2e-15 gb|EKG12988.1| Ribosomal protein L14b/L23e [Macrophomina phaseol... 87 2e-15 ref|XP_007291814.1| 60S ribosomal protein L23 [Marssonina brunne... 87 2e-15 >gb|EXJ92049.1| 60S ribosomal protein L23 [Capronia epimyces CBS 606.96] Length = 115 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 241 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 116 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM Sbjct: 74 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 115 >ref|XP_001221309.1| 60S ribosomal protein L23 [Chaetomium globosum CBS 148.51] gi|88186385|gb|EAQ93853.1| 60S ribosomal protein L23 [Chaetomium globosum CBS 148.51] Length = 139 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 241 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 116 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM Sbjct: 98 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 139 >ref|XP_380978.1| hypothetical protein FG00802.1 [Fusarium graminearum PH-1] gi|342877940|gb|EGU79358.1| hypothetical protein FOXB_10141 [Fusarium oxysporum Fo5176] gi|408390461|gb|EKJ69857.1| hypothetical protein FPSE_09944 [Fusarium pseudograminearum CS3096] gi|517311636|emb|CCT63459.1| probable ribosomal protein L23.e, cytosolic [Fusarium fujikuroi IMI 58289] gi|558855947|gb|ESU06030.1| hypothetical protein FGSG_00802 [Fusarium graminearum PH-1] gi|584126862|gb|EWG36281.1| 60S ribosomal protein L23 [Fusarium verticillioides 7600] gi|587670277|gb|EWY92618.1| 60S ribosomal protein L23 [Fusarium oxysporum FOSC 3-a] gi|587705492|gb|EWZ52097.1| 60S ribosomal protein L23 [Fusarium oxysporum Fo47] gi|587715530|gb|EWZ86867.1| 60S ribosomal protein L23 [Fusarium oxysporum f. sp. lycopersici MN25] gi|587753957|gb|EXA51673.1| 60S ribosomal protein L23 [Fusarium oxysporum f. sp. pisi HDV247] gi|590047533|gb|EXK49391.1| 60S ribosomal protein L23 [Fusarium oxysporum f. sp. melonis 26406] gi|590068911|gb|EXK96435.1| 60S ribosomal protein L23 [Fusarium oxysporum f. sp. raphani 54005] gi|591408999|gb|EXL44136.1| 60S ribosomal protein L23 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591450042|gb|EXL82401.1| 60S ribosomal protein L23 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591462479|gb|EXL94004.1| 60S ribosomal protein L23 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591501246|gb|EXM30639.1| 60S ribosomal protein L23 [Fusarium oxysporum f. sp. vasinfectum 25433] gi|596542078|gb|EYB22576.1| hypothetical protein FG05_00802 [Fusarium graminearum] Length = 139 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 241 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 116 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM Sbjct: 98 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 139 >gb|ETS75063.1| 60S ribosomal protein L23-B [Pestalotiopsis fici W106-1] Length = 115 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 241 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 116 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM Sbjct: 74 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 115 >gb|ETN41674.1| 60S ribosomal protein L23 [Cyphellophora europaea CBS 101466] Length = 140 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 241 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 116 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM Sbjct: 99 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 140 >gb|ETI20689.1| 60S ribosomal protein L23 [Cladophialophora carrionii CBS 160.54] gi|589971807|gb|EXJ55140.1| 60S ribosomal protein L23 [Cladophialophora yegresii CBS 114405] gi|589985648|gb|EXJ68679.1| 60S ribosomal protein L23 [Cladophialophora psammophila CBS 110553] gi|590018588|gb|EXJ93787.1| 60S ribosomal protein L23 [Capronia coronata CBS 617.96] Length = 115 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 241 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 116 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM Sbjct: 74 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 115 >gb|ERS94890.1| 60S ribosomal protein L23 [Sporothrix schenckii ATCC 58251] Length = 178 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 241 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 116 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM Sbjct: 137 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 178 >gb|ERF75540.1| 60S ribosomal protein L23-B [Endocarpon pusillum Z07020] Length = 115 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 241 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 116 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM Sbjct: 74 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 115 >gb|EPQ63865.1| Protein component of the large (60S) ribosomal subunit [Blumeria graminis f. sp. tritici 96224] Length = 125 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 241 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 116 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM Sbjct: 84 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 125 >gb|EPE24736.1| Ribosomal protein L14 [Glarea lozoyensis ATCC 20868] Length = 139 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 241 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 116 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM Sbjct: 98 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 139 >gb|EPE09785.1| 60s ribosomal protein l23 [Ophiostoma piceae UAMH 11346] Length = 125 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 241 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 116 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM Sbjct: 84 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 125 >gb|EON67249.1| 60S ribosomal protein L23 [Coniosporium apollinis CBS 100218] Length = 115 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 241 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 116 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM Sbjct: 74 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 115 >gb|ENH84580.1| 60s ribosomal protein l23 [Colletotrichum orbiculare MAFF 240422] Length = 139 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 241 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 116 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM Sbjct: 98 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 139 >gb|EMR63316.1| putative 60s ribosomal protein l23 protein [Eutypa lata UCREL1] gi|500252385|gb|EON96222.1| putative 60s ribosomal protein l23 protein [Togninia minima UCRPA7] Length = 139 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 241 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 116 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM Sbjct: 98 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 139 >gb|EME83489.1| hypothetical protein MYCFIDRAFT_52202 [Pseudocercospora fijiensis CIRAD86] Length = 140 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 241 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 116 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM Sbjct: 99 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 140 >gb|EME46170.1| hypothetical protein DOTSEDRAFT_70233 [Dothistroma septosporum NZE10] Length = 138 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 241 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 116 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM Sbjct: 97 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 138 >gb|AAO65478.4| alkaline serine protease [Clonostachys rosea] Length = 230 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 241 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 116 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM Sbjct: 110 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 151 >ref|XP_003712412.1| 60S ribosomal protein L23 [Magnaporthe oryzae 70-15] gi|59802848|gb|AAX07639.1| 60S ribosomal protein L23-like protein [Magnaporthe grisea] gi|291195812|gb|ADD84622.1| ribosomal protein L23 [Magnaporthe oryzae] gi|351644744|gb|EHA52605.1| 60S ribosomal protein L23 [Magnaporthe oryzae 70-15] gi|402087619|gb|EJT82517.1| 60S ribosomal protein L23 [Gaeumannomyces graminis var. tritici R3-111a-1] gi|440465499|gb|ELQ34819.1| 60S ribosomal protein L23 [Magnaporthe oryzae Y34] gi|440487718|gb|ELQ67493.1| 60S ribosomal protein L23 [Magnaporthe oryzae P131] Length = 139 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 241 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 116 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM Sbjct: 98 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 139 >gb|EKG12988.1| Ribosomal protein L14b/L23e [Macrophomina phaseolina MS6] Length = 140 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 241 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 116 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM Sbjct: 99 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 140 >ref|XP_007291814.1| 60S ribosomal protein L23 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406865110|gb|EKD18153.1| 60S ribosomal protein L23 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|528290044|emb|CCU82777.1| 60S ribosomal protein L23 [Blumeria graminis f. sp. hordei DH14] Length = 139 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 241 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 116 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM Sbjct: 98 EDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM 139