BLASTX nr result
ID: Akebia25_contig00058464
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00058464 (337 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME83494.1| hypothetical protein MYCFIDRAFT_38837 [Pseudocerc... 73 5e-11 gb|EGX44007.1| hypothetical protein AOL_s00210g168 [Arthrobotrys... 63 5e-08 gb|EPS37792.1| hypothetical protein H072_8346 [Dactylellina hapt... 61 1e-07 emb|CCF46313.1| hypothetical protein CH063_00604 [Colletotrichum... 61 2e-07 ref|XP_001805502.1| hypothetical protein SNOG_15351 [Phaeosphaer... 61 2e-07 gb|EON70080.1| hypothetical protein W97_09346 [Coniosporium apol... 60 2e-07 ref|XP_003041473.1| hypothetical protein NECHADRAFT_44379 [Nectr... 60 4e-07 dbj|GAA92277.1| MFS sugar transporter [Aspergillus kawachii IFO ... 59 5e-07 ref|XP_001391116.1| hexose carrier protein [Aspergillus niger CB... 59 5e-07 gb|ENH87044.1| hexose carrier protein [Colletotrichum orbiculare... 59 9e-07 ref|XP_001826590.1| hexose carrier protein [Aspergillus oryzae R... 59 9e-07 gb|EIT77776.1| putative transporter [Aspergillus oryzae 3.042] 59 9e-07 gb|ERT00356.1| hypothetical protein HMPREF1624_03727 [Sporothrix... 58 1e-06 gb|EQB43753.1| hypothetical protein CGLO_17571 [Colletotrichum g... 58 1e-06 ref|XP_007274764.1| hexose carrier protein [Colletotrichum gloeo... 58 1e-06 ref|XP_001547922.1| hypothetical protein BC1G_13350 [Botryotinia... 57 2e-06 gb|ETS73958.1| hypothetical protein PFICI_13824 [Pestalotiopsis ... 57 3e-06 ref|XP_002377898.1| sugar transporter, putative [Aspergillus fla... 56 5e-06 ref|XP_007594895.1| hypothetical protein CFIO01_07714 [Colletotr... 56 6e-06 >gb|EME83494.1| hypothetical protein MYCFIDRAFT_38837 [Pseudocercospora fijiensis CIRAD86] Length = 488 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/46 (69%), Positives = 39/46 (84%) Frame = -1 Query: 148 MGKSSALFISSFLAIGGFLFGYDSGIVTQAISVPAFVSYFNSPDDN 11 MG+S++ + S+FLAIGGFLFGYDSGI+T AISV F+ YFNSP DN Sbjct: 1 MGRSTSFYSSAFLAIGGFLFGYDSGIITSAISVSEFIKYFNSPSDN 46 >gb|EGX44007.1| hypothetical protein AOL_s00210g168 [Arthrobotrys oligospora ATCC 24927] Length = 488 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = -1 Query: 148 MGKSSALFISSFLAIGGFLFGYDSGIVTQAISVPAFVSYFNSP 20 MGK +F + FLAIGGFLFGYDSGI+T IS+P F+ YF++P Sbjct: 1 MGKGYTIFSTVFLAIGGFLFGYDSGIITSTISLPHFIDYFDAP 43 >gb|EPS37792.1| hypothetical protein H072_8346 [Dactylellina haptotyla CBS 200.50] Length = 490 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = -1 Query: 148 MGKSSALFISSFLAIGGFLFGYDSGIVTQAISVPAFVSYFNSP 20 MGK +F ++FLAIGGFLFGYDSGI+T IS P F YF++P Sbjct: 1 MGKGYTIFATAFLAIGGFLFGYDSGIITSTISQPYFKEYFSTP 43 >emb|CCF46313.1| hypothetical protein CH063_00604 [Colletotrichum higginsianum] Length = 484 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = -1 Query: 148 MGKSSALFISSFLAIGGFLFGYDSGIVTQAISVPAFVSYFNSPDDNTVA 2 MG+ + +F + FLAIGGFLFGYDSGI+T I++P F YF+ P D TVA Sbjct: 1 MGQLTTVFSAVFLAIGGFLFGYDSGIITSTIALPTFEDYFSHPSD-TVA 48 >ref|XP_001805502.1| hypothetical protein SNOG_15351 [Phaeosphaeria nodorum SN15] gi|111056164|gb|EAT77284.1| hypothetical protein SNOG_15351 [Phaeosphaeria nodorum SN15] Length = 488 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/48 (56%), Positives = 33/48 (68%) Frame = -1 Query: 148 MGKSSALFISSFLAIGGFLFGYDSGIVTQAISVPAFVSYFNSPDDNTV 5 MG + +F + FLA GGFLFGYDSGI+T I++P F YFN P D V Sbjct: 1 MGLTITVFSAIFLATGGFLFGYDSGIITSTIALPTFKEYFNDPSDTIV 48 >gb|EON70080.1| hypothetical protein W97_09346 [Coniosporium apollinis CBS 100218] Length = 488 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/48 (56%), Positives = 35/48 (72%) Frame = -1 Query: 148 MGKSSALFISSFLAIGGFLFGYDSGIVTQAISVPAFVSYFNSPDDNTV 5 MGK++ + FLAIGGFLFGYDSGI+T +I+ FV YF+ P+D V Sbjct: 1 MGKATTFLSAIFLAIGGFLFGYDSGIITSSIAQEHFVEYFSKPNDTVV 48 >ref|XP_003041473.1| hypothetical protein NECHADRAFT_44379 [Nectria haematococca mpVI 77-13-4] gi|256722375|gb|EEU35760.1| hypothetical protein NECHADRAFT_44379 [Nectria haematococca mpVI 77-13-4] Length = 487 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/46 (54%), Positives = 35/46 (76%) Frame = -1 Query: 145 GKSSALFISSFLAIGGFLFGYDSGIVTQAISVPAFVSYFNSPDDNT 8 G + + ++FLA+GGFLFGYDSGI++ I++P F YFNSP D+T Sbjct: 4 GDAITIASAAFLAVGGFLFGYDSGIISSTIALPHFKEYFNSPSDDT 49 >dbj|GAA92277.1| MFS sugar transporter [Aspergillus kawachii IFO 4308] Length = 484 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/45 (60%), Positives = 32/45 (71%) Frame = -1 Query: 148 MGKSSALFISSFLAIGGFLFGYDSGIVTQAISVPAFVSYFNSPDD 14 M K S L + FLAIGGFLFGYDSGI+T I F+ YFN+P+D Sbjct: 1 MAKLSTLLSAVFLAIGGFLFGYDSGIITSTIGQTEFIRYFNNPND 45 >ref|XP_001391116.1| hexose carrier protein [Aspergillus niger CBS 513.88] gi|134075581|emb|CAK39247.1| unnamed protein product [Aspergillus niger] Length = 484 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/45 (60%), Positives = 32/45 (71%) Frame = -1 Query: 148 MGKSSALFISSFLAIGGFLFGYDSGIVTQAISVPAFVSYFNSPDD 14 M K S L + FLAIGGFLFGYDSGI+T I F+ YFN+P+D Sbjct: 1 MAKLSTLLSAVFLAIGGFLFGYDSGIITSTIGQTEFIRYFNNPND 45 >gb|ENH87044.1| hexose carrier protein [Colletotrichum orbiculare MAFF 240422] Length = 484 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/45 (55%), Positives = 34/45 (75%) Frame = -1 Query: 148 MGKSSALFISSFLAIGGFLFGYDSGIVTQAISVPAFVSYFNSPDD 14 MG+ + +F + FLAIGGFLFGYDSGI+T I++ F +YF+ P D Sbjct: 1 MGRLTTVFSAVFLAIGGFLFGYDSGIITSTIALDTFKAYFSDPSD 45 >ref|XP_001826590.1| hexose carrier protein [Aspergillus oryzae RIB40] gi|83775335|dbj|BAE65457.1| unnamed protein product [Aspergillus oryzae RIB40] Length = 483 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -1 Query: 130 LFISSFLAIGGFLFGYDSGIVTQAISVPAFVSYFNSPDD 14 LF + FLA+GGFLFGYDSGI+T IS+P F YF +P D Sbjct: 7 LFSAIFLAVGGFLFGYDSGIITSTISLPTFQEYFTNPSD 45 >gb|EIT77776.1| putative transporter [Aspergillus oryzae 3.042] Length = 483 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -1 Query: 130 LFISSFLAIGGFLFGYDSGIVTQAISVPAFVSYFNSPDD 14 LF + FLA+GGFLFGYDSGI+T IS+P F YF +P D Sbjct: 7 LFSAIFLAVGGFLFGYDSGIITSTISLPTFQEYFTNPSD 45 >gb|ERT00356.1| hypothetical protein HMPREF1624_03727 [Sporothrix schenckii ATCC 58251] Length = 490 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/44 (52%), Positives = 34/44 (77%) Frame = -1 Query: 145 GKSSALFISSFLAIGGFLFGYDSGIVTQAISVPAFVSYFNSPDD 14 G S + ++FLA+GGFLFGYDSGI++ I++P F+ YF++P D Sbjct: 5 GSSVTIVSAAFLAVGGFLFGYDSGIISSVIALPTFMDYFHNPSD 48 >gb|EQB43753.1| hypothetical protein CGLO_17571 [Colletotrichum gloeosporioides Cg-14] Length = 484 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/45 (55%), Positives = 33/45 (73%) Frame = -1 Query: 148 MGKSSALFISSFLAIGGFLFGYDSGIVTQAISVPAFVSYFNSPDD 14 MG+ + +F + FLAIGGFLFGYDSGI+T I++ F YF+ P D Sbjct: 1 MGRLTTVFSAVFLAIGGFLFGYDSGIITSTIALDTFKEYFSDPSD 45 >ref|XP_007274764.1| hexose carrier protein [Colletotrichum gloeosporioides Nara gc5] gi|429861473|gb|ELA36160.1| hexose carrier protein [Colletotrichum gloeosporioides Nara gc5] Length = 484 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/45 (55%), Positives = 33/45 (73%) Frame = -1 Query: 148 MGKSSALFISSFLAIGGFLFGYDSGIVTQAISVPAFVSYFNSPDD 14 MG+ + +F + FLAIGGFLFGYDSGI+T I++ F YF+ P D Sbjct: 1 MGRLTTVFSAVFLAIGGFLFGYDSGIITSTIALDTFKEYFSDPSD 45 >ref|XP_001547922.1| hypothetical protein BC1G_13350 [Botryotinia fuckeliana B05.10] gi|347835915|emb|CCD50487.1| similar to MFS sugar transporter [Botryotinia fuckeliana T4] gi|472246595|gb|EMR91127.1| putative hexose carrier protein [Botryotinia fuckeliana BcDW1] Length = 493 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/47 (57%), Positives = 32/47 (68%) Frame = -1 Query: 148 MGKSSALFISSFLAIGGFLFGYDSGIVTQAISVPAFVSYFNSPDDNT 8 MGK+ + FL+IGGFLFGYDSGIVT I P F+SYF D +T Sbjct: 1 MGKAVTIGTGLFLSIGGFLFGYDSGIVTSTIGQPEFISYFGKLDAST 47 >gb|ETS73958.1| hypothetical protein PFICI_13824 [Pestalotiopsis fici W106-1] Length = 485 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = -1 Query: 148 MGKSSALFISS--FLAIGGFLFGYDSGIVTQAISVPAFVSYFNSPDD 14 M K +A+ I+S FLA+GGFLFGYDSGI++ I++P F+ YF P D Sbjct: 1 MAKGNAITIASSAFLAVGGFLFGYDSGIISSTIAMPHFLEYFGHPSD 47 >ref|XP_002377898.1| sugar transporter, putative [Aspergillus flavus NRRL3357] gi|317157097|ref|XP_001826217.2| hexose carrier protein [Aspergillus oryzae RIB40] gi|220696392|gb|EED52734.1| sugar transporter, putative [Aspergillus flavus NRRL3357] Length = 490 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/43 (55%), Positives = 31/43 (72%) Frame = -1 Query: 148 MGKSSALFISSFLAIGGFLFGYDSGIVTQAISVPAFVSYFNSP 20 MG + +F + FLA+GGFLFGYDSGI+T IS+ F YF +P Sbjct: 1 MGHAQTVFSALFLAVGGFLFGYDSGIITSTISLATFKDYFGNP 43 >ref|XP_007594895.1| hypothetical protein CFIO01_07714 [Colletotrichum fioriniae PJ7] gi|588900927|gb|EXF81471.1| hypothetical protein CFIO01_07714 [Colletotrichum fioriniae PJ7] Length = 484 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/49 (55%), Positives = 35/49 (71%) Frame = -1 Query: 148 MGKSSALFISSFLAIGGFLFGYDSGIVTQAISVPAFVSYFNSPDDNTVA 2 MG+ + + + FLAIGGFLFGYDSGI+T I++ F YF+ P D TVA Sbjct: 1 MGRLTTVLSAVFLAIGGFLFGYDSGIITSTIALDTFEKYFSHPSD-TVA 48