BLASTX nr result
ID: Akebia25_contig00058399
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00058399 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001794336.1| hypothetical protein SNOG_03790 [Phaeosphaer... 60 3e-07 gb|EMC91146.1| hypothetical protein BAUCODRAFT_316419 [Baudoinia... 60 4e-07 gb|EKG14644.1| hypothetical protein MPH_08117 [Macrophomina phas... 58 1e-06 gb|EME39221.1| hypothetical protein DOTSEDRAFT_47812 [Dothistrom... 55 8e-06 >ref|XP_001794336.1| hypothetical protein SNOG_03790 [Phaeosphaeria nodorum SN15] gi|111067875|gb|EAT88995.1| hypothetical protein SNOG_03790 [Phaeosphaeria nodorum SN15] Length = 112 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/65 (46%), Positives = 42/65 (64%), Gaps = 1/65 (1%) Frame = -2 Query: 193 YFLFPGGLPKSNVFETDAVKNVGNAFSSGGGTTTHTPAYATKRGDSSSNISR-QEKQKGI 17 Y+L+ N ++T V+N+ + FS+GGG THTP YATKRG S+ N SR Q+ KG Sbjct: 20 YYLYMRQYWFPNPYKTQGVQNIEDRFSAGGGHPTHTPGYATKRGSSTDNESRTQDGHKGP 79 Query: 16 GTQHF 2 ++HF Sbjct: 80 DSEHF 84 >gb|EMC91146.1| hypothetical protein BAUCODRAFT_316419 [Baudoinia compniacensis UAMH 10762] Length = 88 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/54 (50%), Positives = 36/54 (66%) Frame = -2 Query: 163 SNVFETDAVKNVGNAFSSGGGTTTHTPAYATKRGDSSSNISRQEKQKGIGTQHF 2 SNVFET VKN+G+ +++GG + TH AT RG+S + IS Q + KGI T F Sbjct: 3 SNVFETPGVKNIGDRYAAGGASNTHQTGVATPRGNSDNTISNQSQPKGIDTPRF 56 >gb|EKG14644.1| hypothetical protein MPH_08117 [Macrophomina phaseolina MS6] Length = 149 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -2 Query: 166 KSNVFETDAVKNVGNAFSSGGGTTTHTPAYATKRGDSSS 50 KSNVFET +N+GN +S+GGG THTPA ATKRGD +S Sbjct: 30 KSNVFETPGTQNIGNRWSAGGGAPTHTPAGATKRGDPNS 68 >gb|EME39221.1| hypothetical protein DOTSEDRAFT_47812 [Dothistroma septosporum NZE10] Length = 111 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/63 (42%), Positives = 37/63 (58%) Frame = -2 Query: 190 FLFPGGLPKSNVFETDAVKNVGNAFSSGGGTTTHTPAYATKRGDSSSNISRQEKQKGIGT 11 FL P KS ET A +N+ NA+S GGG+ TH P AT RG + +S Q +G+ + Sbjct: 20 FLIPSS-KKSVPLETFATQNIANAYSRGGGSDTHLPGVATTRGKAEETMSNQINPRGVDS 78 Query: 10 QHF 2 +HF Sbjct: 79 KHF 81