BLASTX nr result
ID: Akebia25_contig00058242
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00058242 (438 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002543276.1| conserved hypothetical protein [Uncinocarpus... 56 6e-06 >ref|XP_002543276.1| conserved hypothetical protein [Uncinocarpus reesii 1704] gi|237903542|gb|EEP77943.1| conserved hypothetical protein [Uncinocarpus reesii 1704] Length = 453 Score = 55.8 bits (133), Expect = 6e-06 Identities = 33/72 (45%), Positives = 46/72 (63%), Gaps = 1/72 (1%) Frame = -1 Query: 435 QMTAMSVVQSNMIWK-AKALVDIKDGDSKADPNAGNPTRKPLPHIYTRKMTTADKAGAWT 259 QM AM V QSN+I K A + + G SK DP+AG P+P + R +TTAD+AGAWT Sbjct: 383 QMAAMEVFQSNLIAKVAPPVTESTGGTSKGDPSAG-VREDPVPEL--RDLTTADRAGAWT 439 Query: 258 LTVVACLLSMFG 223 +T V+ + ++ G Sbjct: 440 ITAVSIVTAIPG 451