BLASTX nr result
ID: Akebia25_contig00058188
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00058188 (256 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI26162.3| unnamed protein product [Vitis vinifera] 65 1e-08 ref|XP_006289665.1| hypothetical protein CARUB_v10003224mg [Caps... 60 3e-07 ref|XP_006489230.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 ref|XP_004491488.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 ref|XP_002873920.1| pentatricopeptide repeat-containing protein ... 60 4e-07 ref|XP_006419767.1| hypothetical protein CICLE_v10007051mg, part... 59 7e-07 ref|NP_197396.1| pentatricopeptide repeat-containing protein [Ar... 56 6e-06 >emb|CBI26162.3| unnamed protein product [Vitis vinifera] Length = 636 Score = 65.1 bits (157), Expect = 1e-08 Identities = 33/64 (51%), Positives = 43/64 (67%) Frame = -3 Query: 254 FSPDSAFFNVLFDILLKAKASKVVHSFLESTHFIPEPGYLESLIRCLLVDGAIHKALHVF 75 FSPDS+ NVLFD L++A A SFL+ST+F P+P LE+ IRCL G + +A+ VF Sbjct: 156 FSPDSSSCNVLFDALVEAGACNAAKSFLDSTNFNPKPASLEAYIRCLCKGGLVEEAISVF 215 Query: 74 S*LK 63 LK Sbjct: 216 GQLK 219 >ref|XP_006289665.1| hypothetical protein CARUB_v10003224mg [Capsella rubella] gi|482558371|gb|EOA22563.1| hypothetical protein CARUB_v10003224mg [Capsella rubella] Length = 486 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/64 (45%), Positives = 42/64 (65%) Frame = -3 Query: 254 FSPDSAFFNVLFDILLKAKASKVVHSFLESTHFIPEPGYLESLIRCLLVDGAIHKALHVF 75 ++PD A ++LF LL AKA K SFL++T F PEP LE ++CL DG + +A+ V+ Sbjct: 112 YAPDPASLSLLFGALLDAKAVKAAKSFLDTTGFKPEPTLLEQYVKCLSEDGLVEEAIDVY 171 Query: 74 S*LK 63 + LK Sbjct: 172 NVLK 175 >ref|XP_006489230.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18950-like [Citrus sinensis] Length = 589 Score = 59.7 bits (143), Expect = 4e-07 Identities = 33/64 (51%), Positives = 39/64 (60%) Frame = -3 Query: 254 FSPDSAFFNVLFDILLKAKASKVVHSFLESTHFIPEPGYLESLIRCLLVDGAIHKALHVF 75 FSPD NVLFD L++A+A KV FL+ T F P P LE I+CL G I +A VF Sbjct: 102 FSPDLDSCNVLFDSLVEARAFKVAMDFLDITGFSPNPNSLELYIQCLCESGMIEEAFRVF 161 Query: 74 S*LK 63 S LK Sbjct: 162 SKLK 165 >ref|XP_004491488.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18950-like isoform X1 [Cicer arietinum] gi|502099479|ref|XP_004491489.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18950-like isoform X2 [Cicer arietinum] Length = 598 Score = 59.7 bits (143), Expect = 4e-07 Identities = 32/64 (50%), Positives = 39/64 (60%) Frame = -3 Query: 254 FSPDSAFFNVLFDILLKAKASKVVHSFLESTHFIPEPGYLESLIRCLLVDGAIHKALHVF 75 FSPD + NVLFD L+ A+A K S L+ F P+P LES IRCL+ G + AL VF Sbjct: 115 FSPDQSSCNVLFDALVDAEACKAAKSLLDYPGFTPKPASLESYIRCLINGGMVEDALDVF 174 Query: 74 S*LK 63 LK Sbjct: 175 VTLK 178 >ref|XP_002873920.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297319757|gb|EFH50179.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 483 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/64 (43%), Positives = 41/64 (64%) Frame = -3 Query: 254 FSPDSAFFNVLFDILLKAKASKVVHSFLESTHFIPEPGYLESLIRCLLVDGAIHKALHVF 75 ++PDS N+LF LL KA K SFL++T F PEP LE ++CL +G + +A+ V+ Sbjct: 109 YTPDSVSLNLLFGALLDGKAVKAAKSFLDTTGFKPEPTLLEQYVKCLSEEGLVEEAIEVY 168 Query: 74 S*LK 63 + LK Sbjct: 169 NVLK 172 >ref|XP_006419767.1| hypothetical protein CICLE_v10007051mg, partial [Citrus clementina] gi|557521640|gb|ESR33007.1| hypothetical protein CICLE_v10007051mg, partial [Citrus clementina] Length = 540 Score = 58.9 bits (141), Expect = 7e-07 Identities = 33/64 (51%), Positives = 38/64 (59%) Frame = -3 Query: 254 FSPDSAFFNVLFDILLKAKASKVVHSFLESTHFIPEPGYLESLIRCLLVDGAIHKALHVF 75 FSPD NVLFD L++A+A KV FL T F P P LE I+CL G I +A VF Sbjct: 70 FSPDLDSCNVLFDSLVEARAFKVAKEFLAITGFSPNPNSLELYIQCLCESGMIEEAFRVF 129 Query: 74 S*LK 63 S LK Sbjct: 130 SKLK 133 >ref|NP_197396.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635758|sp|Q8GYM2.2|PP393_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g18950 gi|332005249|gb|AED92632.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 483 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/64 (40%), Positives = 39/64 (60%) Frame = -3 Query: 254 FSPDSAFFNVLFDILLKAKASKVVHSFLESTHFIPEPGYLESLIRCLLVDGAIHKALHVF 75 ++P N+LF LL KA K SFL++T F PEP LE ++CL +G + +A+ V+ Sbjct: 109 YTPGPVSLNILFGALLDGKAVKAAKSFLDTTGFKPEPTLLEQYVKCLSEEGLVEEAIEVY 168 Query: 74 S*LK 63 + LK Sbjct: 169 NVLK 172