BLASTX nr result
ID: Akebia25_contig00057840
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00057840 (259 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAE56502.1| unnamed protein product [Aspergillus oryzae RIB40] 59 9e-07 ref|XP_001249003.1| hypothetical protein CIMG_02774 [Coccidioide... 58 1e-06 gb|AAR29046.2| gag-pol polyprotein [Aspergillus flavus] 57 3e-06 gb|EMS23864.1| Chromo domain containing protein [Rhodosporidium ... 57 4e-06 gb|EGU13136.1| Proteophosphoglycan ppg4 [Rhodotorula glutinis AT... 57 4e-06 gb|AGC39045.1| chromobox-like protein 5 [Helicoverpa armigera] 56 6e-06 ref|XP_003170595.1| hypothetical protein MGYG_09171 [Arthroderma... 55 8e-06 ref|XP_003169023.1| hypothetical protein MGYG_09215 [Arthroderma... 55 8e-06 >dbj|BAE56502.1| unnamed protein product [Aspergillus oryzae RIB40] Length = 975 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/61 (42%), Positives = 35/61 (57%) Frame = -2 Query: 189 KGLSGKPLSIHYLVKWKGYSEQEASWEPAENLRNATEAIKDFEMKRQQRTARSPGPDEPQ 10 K ++GKP HYLVKWKGYS E SWEP ENL + ++ + ++ Q + R G Sbjct: 872 KRVNGKP---HYLVKWKGYSTSENSWEPIENLTGCHQLVRQYHQRKDQNSPRRKGHPSAD 928 Query: 9 P 7 P Sbjct: 929 P 929 >ref|XP_001249003.1| hypothetical protein CIMG_02774 [Coccidioides immitis RS] gi|392861807|gb|EJB10397.1| hypothetical protein CIMG_12626 [Coccidioides immitis RS] Length = 239 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/37 (62%), Positives = 31/37 (83%) Frame = -2 Query: 159 HYLVKWKGYSEQEASWEPAENLRNATEAIKDFEMKRQ 49 HYLVKWKG+S ++++WEP ENL+NA E +KD+ KRQ Sbjct: 171 HYLVKWKGFSIEKSTWEPEENLKNAQETLKDYLKKRQ 207 >gb|AAR29046.2| gag-pol polyprotein [Aspergillus flavus] Length = 1998 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/56 (44%), Positives = 35/56 (62%) Frame = -2 Query: 192 DKGLSGKPLSIHYLVKWKGYSEQEASWEPAENLRNATEAIKDFEMKRQQRTARSPG 25 DK ++GKP HYLVKWKGYS E SWEP ENL + ++ + ++ Q + + G Sbjct: 1939 DKRVNGKP---HYLVKWKGYSTSENSWEPIENLTGCHQLVRQYHQQKGQNSPKRRG 1991 >gb|EMS23864.1| Chromo domain containing protein [Rhodosporidium toruloides NP11] Length = 813 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/44 (47%), Positives = 32/44 (72%) Frame = -2 Query: 165 SIHYLVKWKGYSEQEASWEPAENLRNATEAIKDFEMKRQQRTAR 34 ++ YLVKWKGYSE E +WEP ENL N + + ++ ++++R AR Sbjct: 57 AMRYLVKWKGYSEDEKTWEPIENLENCLDLVTEYNKRKEEREAR 100 >gb|EGU13136.1| Proteophosphoglycan ppg4 [Rhodotorula glutinis ATCC 204091] Length = 814 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/44 (47%), Positives = 32/44 (72%) Frame = -2 Query: 165 SIHYLVKWKGYSEQEASWEPAENLRNATEAIKDFEMKRQQRTAR 34 ++ YLVKWKGYSE E +WEP ENL N + + ++ ++++R AR Sbjct: 57 AMRYLVKWKGYSEDEKTWEPIENLENCLDLVTEYNKRKEEREAR 100 >gb|AGC39045.1| chromobox-like protein 5 [Helicoverpa armigera] Length = 191 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/49 (46%), Positives = 36/49 (73%) Frame = -2 Query: 162 IHYLVKWKGYSEQEASWEPAENLRNATEAIKDFEMKRQQRTARSPGPDE 16 + YL+KWKGY E+E++WEP ENL + E IK FE R+++ A++ P++ Sbjct: 34 VQYLLKWKGYKEEESTWEPVENL-DCEELIKTFEDNRKEKEAKTKKPED 81 >ref|XP_003170595.1| hypothetical protein MGYG_09171 [Arthroderma gypseum CBS 118893] gi|311345629|gb|EFR04832.1| hypothetical protein MGYG_09171 [Arthroderma gypseum CBS 118893] Length = 1868 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/50 (48%), Positives = 36/50 (72%) Frame = -2 Query: 192 DKGLSGKPLSIHYLVKWKGYSEQEASWEPAENLRNATEAIKDFEMKRQQR 43 +K ++GK IHYLVKWKGY + E ++EP NL+NAT+AI+ + +R + Sbjct: 1751 EKRINGK---IHYLVKWKGYDDSENTYEPMRNLQNATQAIEKYHQRRDSQ 1797 >ref|XP_003169023.1| hypothetical protein MGYG_09215 [Arthroderma gypseum CBS 118893] gi|311337753|gb|EFQ96955.1| hypothetical protein MGYG_09215 [Arthroderma gypseum CBS 118893] Length = 333 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/50 (48%), Positives = 36/50 (72%) Frame = -2 Query: 192 DKGLSGKPLSIHYLVKWKGYSEQEASWEPAENLRNATEAIKDFEMKRQQR 43 +K ++GK IHYLVKWKGY + E ++EP NL+NAT+AI+ + +R + Sbjct: 266 EKRINGK---IHYLVKWKGYDDSENTYEPMRNLQNATQAIEKYHQRRDSQ 312