BLASTX nr result
ID: Akebia25_contig00057617
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00057617 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADJ67431.1| ethylene response factor 2 [Actinidia deliciosa] 65 1e-08 ref|XP_007039780.1| Integrase-type DNA-binding superfamily prote... 60 4e-07 >gb|ADJ67431.1| ethylene response factor 2 [Actinidia deliciosa] Length = 264 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = +2 Query: 167 ESNTKKDNKRVLEAKDVNETKRRNKSGKDSKHPTYRGVRMRNWGKW 304 E K +RV E K+ NE ++R+KSG D KHPTYRGVR+RNWGKW Sbjct: 64 EGKAIKGQRRVEETKNGNEHRKRHKSGGDEKHPTYRGVRIRNWGKW 109 >ref|XP_007039780.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma cacao] gi|508777025|gb|EOY24281.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma cacao] Length = 237 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/50 (52%), Positives = 39/50 (78%), Gaps = 1/50 (2%) Frame = +2 Query: 158 ILTESNTKKDNKRVLEAKDVNETKRRNKSGK-DSKHPTYRGVRMRNWGKW 304 + +ES+T+ +K+V + K+ NE+KR+ K+ + + KHPTYRGVRMR WGKW Sbjct: 22 LASESSTRFKSKKVEKVKNANESKRKVKNDEVEGKHPTYRGVRMRQWGKW 71