BLASTX nr result
ID: Akebia25_contig00057546
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00057546 (326 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT05159.1| hypothetical protein F775_31525 [Aegilops tauschii] 59 9e-07 sp|P08743.2|COX1_OENBE RecName: Full=Cytochrome c oxidase subuni... 55 6e-06 prf||1303229A cytochrome oxidase I 55 6e-06 gb|AAD01665.1| cytochrome c oxidase [Oenothera biennis] 55 6e-06 emb|CAA64277.1| cytochrome c oxidase [Bazzania trilobata] 55 8e-06 >gb|EMT05159.1| hypothetical protein F775_31525 [Aegilops tauschii] Length = 61 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 223 SPPMVNEKMDPTTNNMGVLYCIEPPQIVAI 312 SPPMVN+KM+PT NNMGVLYCIEPP +VAI Sbjct: 13 SPPMVNKKMNPTANNMGVLYCIEPPHMVAI 42 >sp|P08743.2|COX1_OENBE RecName: Full=Cytochrome c oxidase subunit 1; AltName: Full=Cytochrome c oxidase polypeptide I gi|13167|emb|CAA29025.1| unnamed protein product [Oenothera berteroana] Length = 527 Score = 54.7 bits (130), Expect(2) = 6e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 311 IATI*GGSIQYKTPMLFVVGSIFSFTIGGLA 219 IAT+ GGSIQYKTPMLF VGSIF FT+GGLA Sbjct: 326 IATMWGGSIQYKTPMLFAVGSIFLFTVGGLA 356 Score = 20.8 bits (42), Expect(2) = 6e-06 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -2 Query: 100 YYIGSYFHPLLS 65 YY G++FH +LS Sbjct: 373 YYAGAHFHYVLS 384 >prf||1303229A cytochrome oxidase I Length = 527 Score = 54.7 bits (130), Expect(2) = 6e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 311 IATI*GGSIQYKTPMLFVVGSIFSFTIGGLA 219 IAT+ GGSIQYKTPMLF VGSIF FT+GGLA Sbjct: 326 IATMWGGSIQYKTPMLFAVGSIFLFTVGGLA 356 Score = 20.8 bits (42), Expect(2) = 6e-06 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -2 Query: 100 YYIGSYFHPLLS 65 YY G++FH +LS Sbjct: 373 YYAGAHFHYVLS 384 >gb|AAD01665.1| cytochrome c oxidase [Oenothera biennis] Length = 471 Score = 54.7 bits (130), Expect(2) = 6e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 311 IATI*GGSIQYKTPMLFVVGSIFSFTIGGLA 219 IAT+ GGSIQYKTPMLF VGSIF FT+GGLA Sbjct: 291 IATMWGGSIQYKTPMLFAVGSIFLFTVGGLA 321 Score = 20.8 bits (42), Expect(2) = 6e-06 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -2 Query: 100 YYIGSYFHPLLS 65 YY G++FH +LS Sbjct: 338 YYAGAHFHYVLS 349 >emb|CAA64277.1| cytochrome c oxidase [Bazzania trilobata] Length = 140 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 311 IATI*GGSIQYKTPMLFVVGSIFSFTIGGL 222 IAT+ GGSIQYKTPMLF VGSIFSFT+GGL Sbjct: 106 IATMWGGSIQYKTPMLFAVGSIFSFTVGGL 135