BLASTX nr result
ID: Akebia25_contig00057498
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00057498 (265 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETS75130.1| hypothetical protein PFICI_13614 [Pestalotiopsis ... 62 6e-08 gb|EGY15110.1| serine/threonine-protein kinase srk1 [Verticilliu... 60 4e-07 >gb|ETS75130.1| hypothetical protein PFICI_13614 [Pestalotiopsis fici W106-1] Length = 621 Score = 62.4 bits (150), Expect = 6e-08 Identities = 33/44 (75%), Positives = 35/44 (79%), Gaps = 3/44 (6%) Frame = +3 Query: 141 MSTIQQLKNFIRHGKQART-NNHDDSQRRNPSPPT--ASNAHKA 263 MSTIQQLKNFIRHGKQART NNHDDSQR+N PT + HKA Sbjct: 1 MSTIQQLKNFIRHGKQARTNNNHDDSQRKNDHSPTNVPAQQHKA 44 >gb|EGY15110.1| serine/threonine-protein kinase srk1 [Verticillium dahliae VdLs.17] Length = 599 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = +3 Query: 141 MSTIQQLKNFIRHGKQARTNNHDDSQRRNPSPPTASNAHKA 263 MSTIQQLKNFIRHGKQARTNN+D++Q++N S P + A A Sbjct: 1 MSTIQQLKNFIRHGKQARTNNYDEAQQKNNSSPPRAPAAPA 41