BLASTX nr result
ID: Akebia25_contig00057431
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00057431 (242 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001799766.1| hypothetical protein SNOG_09474 [Phaeosphaer... 58 2e-06 gb|EON67856.1| hypothetical protein W97_07353 [Coniosporium apol... 57 3e-06 >ref|XP_001799766.1| hypothetical protein SNOG_09474 [Phaeosphaeria nodorum SN15] gi|160702562|gb|EAT82739.2| hypothetical protein SNOG_09474 [Phaeosphaeria nodorum SN15] Length = 201 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/50 (60%), Positives = 32/50 (64%) Frame = -2 Query: 238 PPLAAYAVNRTRRGAAAHHIRAECERFCCETLRAVFLGEGRLATSGSLEL 89 PPLAA R RRG AA+ I ECER CETLR+VFLGEG SL L Sbjct: 10 PPLAAKHTPRARRGGAAYTITGECERLFCETLRSVFLGEGSQICEDSLVL 59 >gb|EON67856.1| hypothetical protein W97_07353 [Coniosporium apollinis CBS 100218] Length = 278 Score = 56.6 bits (135), Expect = 3e-06 Identities = 31/64 (48%), Positives = 36/64 (56%), Gaps = 13/64 (20%) Frame = -2 Query: 241 SPPLAA-------------YAVNRTRRGAAAHHIRAECERFCCETLRAVFLGEGRLATSG 101 SPPLAA ++V R RRG AA+ I ECER CETL+ VFLGEG L Sbjct: 39 SPPLAAAQHALKDTTIPKNFSVRRARRGGAAYTIAGECERLFCETLKTVFLGEGNLVCQD 98 Query: 100 SLEL 89 SL + Sbjct: 99 SLAM 102