BLASTX nr result
ID: Akebia25_contig00057342
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00057342 (210 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006398595.1| hypothetical protein EUTSA_v10012920mg [Eutr... 56 5e-06 >ref|XP_006398595.1| hypothetical protein EUTSA_v10012920mg [Eutrema salsugineum] gi|557099685|gb|ESQ40048.1| hypothetical protein EUTSA_v10012920mg [Eutrema salsugineum] Length = 652 Score = 56.2 bits (134), Expect = 5e-06 Identities = 30/66 (45%), Positives = 43/66 (65%) Frame = +2 Query: 5 KYEEANTNTSDHHSTIDQLKQEVGELKAFSMEQSRKICSLEKKLAESDTKLHQLKCRVKL 184 K ++ + +S TI QL QEV EL+A+ ME S KIC LE+KL E+ ++ +L+ R K+ Sbjct: 277 KGDDISLVSSPRQPTISQLMQEVKELRAYGMENSTKICYLEEKLDEAHKEIQRLRERCKM 336 Query: 185 LESQLG 202 LES G Sbjct: 337 LESLSG 342