BLASTX nr result
ID: Akebia25_contig00057188
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00057188 (236 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME44268.1| hypothetical protein DOTSEDRAFT_71936 [Dothistrom... 56 6e-06 >gb|EME44268.1| hypothetical protein DOTSEDRAFT_71936 [Dothistroma septosporum NZE10] Length = 2140 Score = 55.8 bits (133), Expect = 6e-06 Identities = 35/77 (45%), Positives = 39/77 (50%), Gaps = 2/77 (2%) Frame = +1 Query: 4 EDGLVQGPEG-PVGKLVEGDAEDLAGYPXXXXXXXXXXXXXXVGRVELLPDQA-XXXXXX 177 EDG V EG P+G+L EGDAEDLAGYP VGRVELLPD+ Sbjct: 427 EDGQVVDKEGNPIGRLAEGDAEDLAGYPIGDDGEILDDDGDLVGRVELLPDEVKKQLQEA 486 Query: 178 XXXXXXXXXGAEDILNQ 228 GAED L+Q Sbjct: 487 REQGEELPPGAEDFLSQ 503