BLASTX nr result
ID: Akebia25_contig00057118
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00057118 (230 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520182.1| leucine-rich repeat containing protein, puta... 59 5e-07 ref|XP_006357280.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CON... 55 8e-06 ref|XP_002268324.2| PREDICTED: protein SUPPRESSOR OF npr1-1, CON... 55 8e-06 >ref|XP_002520182.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223540674|gb|EEF42237.1| leucine-rich repeat containing protein, putative [Ricinus communis] Length = 1349 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/44 (59%), Positives = 35/44 (79%), Gaps = 3/44 (6%) Frame = +3 Query: 108 NSISSPSFKFRWDVFLSFRGED---NFTHRLYTELVRNSIRTFR 230 ++ S+PSF++RWDVFLSFRGED FT LY EL+++ +RTFR Sbjct: 8 DATSTPSFRYRWDVFLSFRGEDTRHTFTENLYRELIKHGVRTFR 51 >ref|XP_006357280.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like [Solanum tuberosum] Length = 1375 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/50 (54%), Positives = 32/50 (64%), Gaps = 3/50 (6%) Frame = +3 Query: 87 MEDDLTSNSISSPSFKFRWDVFLSFRGED---NFTHRLYTELVRNSIRTF 227 M DD + +FRWD+FLSFRGED FT +LY ELVRN +RTF Sbjct: 1 MADDEAEAWSMTSGHRFRWDIFLSFRGEDTRHGFTEKLYNELVRNGVRTF 50 >ref|XP_002268324.2| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like [Vitis vinifera] Length = 1378 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/41 (65%), Positives = 31/41 (75%), Gaps = 3/41 (7%) Frame = +3 Query: 117 SSPSFKFRWDVFLSFRGED---NFTHRLYTELVRNSIRTFR 230 S+ +F+ RWDVFLSFRGED NFT LYT+L RN IR FR Sbjct: 13 STTAFRHRWDVFLSFRGEDTRHNFTDHLYTQLDRNGIRAFR 53