BLASTX nr result
ID: Akebia25_contig00057051
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00057051 (325 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON64446.1| carbamoyl-phosphate synthase arginine-specific sm... 83 5e-14 gb|EUN22286.1| glycoside hydrolase family 3 protein [Bipolaris v... 77 2e-12 gb|EUC36365.1| glycoside hydrolase family 3 protein [Bipolaris z... 77 2e-12 gb|EUC48154.1| glycoside hydrolase family 3 protein [Bipolaris o... 76 4e-12 gb|EOA83224.1| glycoside hydrolase family 3 protein [Setosphaeri... 76 4e-12 gb|ENI04649.1| glycoside hydrolase family 3 protein [Bipolaris m... 76 4e-12 gb|EMD92965.1| hypothetical protein COCHEDRAFT_1029204 [Bipolari... 76 4e-12 gb|EMD63768.1| glycoside hydrolase family 3 protein [Bipolaris s... 76 4e-12 ref|XP_003298460.1| hypothetical protein PTT_09195 [Pyrenophora ... 76 4e-12 ref|XP_001939745.1| carbamoyl-phosphate synthase arginine-specif... 76 4e-12 ref|XP_001803201.1| hypothetical protein SNOG_12987 [Phaeosphaer... 76 4e-12 gb|EME45497.1| hypothetical protein DOTSEDRAFT_150573 [Dothistro... 75 1e-11 gb|EKG18324.1| hypothetical protein MPH_04406 [Macrophomina phas... 74 3e-11 gb|EMF10420.1| small subunit of carbamoyl phosphate synthase [Sp... 73 4e-11 ref|XP_001217969.1| carbamoyl-phosphate synthase arginine-specif... 72 6e-11 ref|XP_002568792.1| Pc21g17970 [Penicillium chrysogenum Wisconsi... 72 8e-11 dbj|GAD91931.1| carbamoyl-phosphate synthase, small subunit [Bys... 72 1e-10 ref|XP_001274012.1| carbamoyl-phosphate synthase, small subunit ... 71 2e-10 gb|EME84194.1| hypothetical protein MYCFIDRAFT_163024 [Pseudocer... 70 2e-10 ref|XP_003840918.1| similar to carbamoyl-phosphate synthase argi... 70 2e-10 >gb|EON64446.1| carbamoyl-phosphate synthase arginine-specific small chain [Coniosporium apollinis CBS 100218] Length = 477 Score = 82.8 bits (203), Expect = 5e-14 Identities = 36/58 (62%), Positives = 51/58 (87%), Gaps = 4/58 (6%) Frame = +2 Query: 2 GGPLDSSYLFDAYLKEVRQYRSNK----PEKATRPSPLLVDLLAKERVGVHPGIPDYQ 163 GGPLDS+YLFDAY++ V++Y++++ P+K +PSPLLVDLL+KERVGVHPG+PD++ Sbjct: 399 GGPLDSAYLFDAYIENVKKYKNSQAVFSPQKDNKPSPLLVDLLSKERVGVHPGLPDFR 456 >gb|EUN22286.1| glycoside hydrolase family 3 protein [Bipolaris victoriae FI3] Length = 1244 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/57 (61%), Positives = 47/57 (82%), Gaps = 3/57 (5%) Frame = +2 Query: 2 GGPLDSSYLFDAYLKEVRQYR---SNKPEKATRPSPLLVDLLAKERVGVHPGIPDYQ 163 GGPLDS+YLFD Y++ V+QY+ +N +++ +PSPLLVDLLAKERVGVHP PD++ Sbjct: 1155 GGPLDSAYLFDKYIENVQQYKDQQANFSQRSNKPSPLLVDLLAKERVGVHPDAPDFE 1211 >gb|EUC36365.1| glycoside hydrolase family 3 protein [Bipolaris zeicola 26-R-13] Length = 1244 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/57 (61%), Positives = 47/57 (82%), Gaps = 3/57 (5%) Frame = +2 Query: 2 GGPLDSSYLFDAYLKEVRQYR---SNKPEKATRPSPLLVDLLAKERVGVHPGIPDYQ 163 GGPLDS+YLFD Y++ V+QY+ +N +++ +PSPLLVDLLAKERVGVHP PD++ Sbjct: 1155 GGPLDSAYLFDKYIENVQQYKDQQANFSQRSNKPSPLLVDLLAKERVGVHPDAPDFE 1211 >gb|EUC48154.1| glycoside hydrolase family 3 protein [Bipolaris oryzae ATCC 44560] Length = 1244 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/57 (59%), Positives = 46/57 (80%), Gaps = 3/57 (5%) Frame = +2 Query: 2 GGPLDSSYLFDAYLKEVRQYRSNKP---EKATRPSPLLVDLLAKERVGVHPGIPDYQ 163 GGPLDS+YLFD Y++ V+QY+ + +++ +PSPLLVDLLAKERVGVHP PD++ Sbjct: 1155 GGPLDSAYLFDKYIENVQQYKEQQASFSQRSNKPSPLLVDLLAKERVGVHPDAPDFE 1211 >gb|EOA83224.1| glycoside hydrolase family 3 protein [Setosphaeria turcica Et28A] Length = 1255 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/57 (59%), Positives = 46/57 (80%), Gaps = 3/57 (5%) Frame = +2 Query: 2 GGPLDSSYLFDAYLKEVRQYRSNKP---EKATRPSPLLVDLLAKERVGVHPGIPDYQ 163 GGPLDS+YLFD Y++ V+QY+ + +++ +PSPLLVDLLAKERVGVHP PD++ Sbjct: 1166 GGPLDSAYLFDKYIENVQQYKDQQASFSQRSNKPSPLLVDLLAKERVGVHPDAPDFE 1222 >gb|ENI04649.1| glycoside hydrolase family 3 protein [Bipolaris maydis ATCC 48331] Length = 1243 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/57 (59%), Positives = 46/57 (80%), Gaps = 3/57 (5%) Frame = +2 Query: 2 GGPLDSSYLFDAYLKEVRQYRSNKP---EKATRPSPLLVDLLAKERVGVHPGIPDYQ 163 GGPLDS+YLFD Y++ V+QY+ + +++ +PSPLLVDLLAKERVGVHP PD++ Sbjct: 1154 GGPLDSAYLFDKYIENVQQYKEQQASFSQRSNKPSPLLVDLLAKERVGVHPDAPDFE 1210 >gb|EMD92965.1| hypothetical protein COCHEDRAFT_1029204 [Bipolaris maydis C5] Length = 489 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/57 (59%), Positives = 46/57 (80%), Gaps = 3/57 (5%) Frame = +2 Query: 2 GGPLDSSYLFDAYLKEVRQYRSNKP---EKATRPSPLLVDLLAKERVGVHPGIPDYQ 163 GGPLDS+YLFD Y++ V+QY+ + +++ +PSPLLVDLLAKERVGVHP PD++ Sbjct: 400 GGPLDSAYLFDKYIENVQQYKEQQASFSQRSNKPSPLLVDLLAKERVGVHPDAPDFE 456 >gb|EMD63768.1| glycoside hydrolase family 3 protein [Bipolaris sorokiniana ND90Pr] Length = 1244 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/57 (59%), Positives = 46/57 (80%), Gaps = 3/57 (5%) Frame = +2 Query: 2 GGPLDSSYLFDAYLKEVRQYRSNKP---EKATRPSPLLVDLLAKERVGVHPGIPDYQ 163 GGPLDS+YLFD Y++ V+QY+ + +++ +PSPLLVDLLAKERVGVHP PD++ Sbjct: 1155 GGPLDSAYLFDKYIENVQQYKEQQASFSQRSNKPSPLLVDLLAKERVGVHPDAPDFE 1211 >ref|XP_003298460.1| hypothetical protein PTT_09195 [Pyrenophora teres f. teres 0-1] gi|311328327|gb|EFQ93452.1| hypothetical protein PTT_09195 [Pyrenophora teres f. teres 0-1] Length = 1255 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/57 (59%), Positives = 47/57 (82%), Gaps = 3/57 (5%) Frame = +2 Query: 2 GGPLDSSYLFDAYLKEVRQYRSNKP---EKATRPSPLLVDLLAKERVGVHPGIPDYQ 163 GGPLDS+YLFD Y++ V+QY+S++ E+ +PSPLLVDLL+K+RVGVHP PD++ Sbjct: 1166 GGPLDSAYLFDKYMENVQQYKSHQAGLSERNNKPSPLLVDLLSKQRVGVHPAAPDFE 1222 >ref|XP_001939745.1| carbamoyl-phosphate synthase arginine-specific small chain [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187975838|gb|EDU42464.1| carbamoyl-phosphate synthase arginine-specific small chain [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 444 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/57 (59%), Positives = 47/57 (82%), Gaps = 3/57 (5%) Frame = +2 Query: 2 GGPLDSSYLFDAYLKEVRQYRSNKP---EKATRPSPLLVDLLAKERVGVHPGIPDYQ 163 GGPLDS+YLFD Y++ V+QY+S++ E+ +PSPLLVDLL+K+RVGVHP PD++ Sbjct: 355 GGPLDSAYLFDKYMENVQQYKSHQAGFSERNNKPSPLLVDLLSKQRVGVHPAAPDFE 411 >ref|XP_001803201.1| hypothetical protein SNOG_12987 [Phaeosphaeria nodorum SN15] gi|121934833|sp|Q0U5H7.1|CARA_PHANO RecName: Full=Carbamoyl-phosphate synthase arginine-specific small chain; Short=CPS-A; AltName: Full=Arginine-specific carbamoyl-phosphate synthetase, glutamine chain gi|111058667|gb|EAT79787.1| hypothetical protein SNOG_12987 [Phaeosphaeria nodorum SN15] Length = 476 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/57 (59%), Positives = 47/57 (82%), Gaps = 3/57 (5%) Frame = +2 Query: 2 GGPLDSSYLFDAYLKEVRQYRSNKP---EKATRPSPLLVDLLAKERVGVHPGIPDYQ 163 GGP+DSSYLFD Y++ V++Y+ ++ EK+ +PSPLLVDLL+KERVGVHP PD++ Sbjct: 393 GGPMDSSYLFDKYIQNVQRYKDHQSSFSEKSNKPSPLLVDLLSKERVGVHPAQPDFE 449 >gb|EME45497.1| hypothetical protein DOTSEDRAFT_150573 [Dothistroma septosporum NZE10] Length = 456 Score = 75.1 bits (183), Expect = 1e-11 Identities = 38/54 (70%), Positives = 43/54 (79%), Gaps = 4/54 (7%) Frame = +2 Query: 2 GGPLDSSYLFDAYLKEVRQYRSN----KPEKATRPSPLLVDLLAKERVGVHPGI 151 GGPLDSSYLFDAYL+ V+QY+ N K + RPSPLLVDLLAKERVGV PG+ Sbjct: 396 GGPLDSSYLFDAYLQSVQQYKQNQDVLKGGRDNRPSPLLVDLLAKERVGVAPGV 449 >gb|EKG18324.1| hypothetical protein MPH_04406 [Macrophomina phaseolina MS6] Length = 471 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/57 (61%), Positives = 44/57 (77%), Gaps = 4/57 (7%) Frame = +2 Query: 2 GGPLDSSYLFDAYLKEVRQYRSNKPE----KATRPSPLLVDLLAKERVGVHPGIPDY 160 GGPLDS+YLFD Y+ VR Y+ ++ K+ +P+PLLVDLL KERVGVHPGIP+Y Sbjct: 395 GGPLDSAYLFDKYIDCVRAYKDSQSVFSAGKSNKPNPLLVDLLPKERVGVHPGIPEY 451 >gb|EMF10420.1| small subunit of carbamoyl phosphate synthase [Sphaerulina musiva SO2202] Length = 458 Score = 73.2 bits (178), Expect = 4e-11 Identities = 38/59 (64%), Positives = 43/59 (72%), Gaps = 4/59 (6%) Frame = +2 Query: 2 GGPLDSSYLFDAYLKEVRQYRSN----KPEKATRPSPLLVDLLAKERVGVHPGIPDYQS 166 GGPLDSSYLFDAYL V+QY++ K K RPSPLLVDLLAKERVGV P + + S Sbjct: 399 GGPLDSSYLFDAYLNSVQQYKAQNDTLKGGKDNRPSPLLVDLLAKERVGVSPNVSPHAS 457 >ref|XP_001217969.1| carbamoyl-phosphate synthase arginine-specific small chain, mitochondrial precursor [Aspergillus terreus NIH2624] gi|114188784|gb|EAU30484.1| carbamoyl-phosphate synthase arginine-specific small chain, mitochondrial precursor [Aspergillus terreus NIH2624] Length = 431 Score = 72.4 bits (176), Expect = 6e-11 Identities = 35/54 (64%), Positives = 44/54 (81%), Gaps = 4/54 (7%) Frame = +2 Query: 2 GGPLDSSYLFDAYLKEVRQYRSNK----PEKATRPSPLLVDLLAKERVGVHPGI 151 GGPLDSSYLFD YL VR+Y++++ PE+ +RP+PLLVDLLAKERVGV P + Sbjct: 363 GGPLDSSYLFDIYLDSVRKYKNSQLAVYPERDSRPNPLLVDLLAKERVGVQPTV 416 >ref|XP_002568792.1| Pc21g17970 [Penicillium chrysogenum Wisconsin 54-1255] gi|211590503|emb|CAP96694.1| Pc21g17970 [Penicillium chrysogenum Wisconsin 54-1255] Length = 454 Score = 72.0 bits (175), Expect = 8e-11 Identities = 36/54 (66%), Positives = 43/54 (79%), Gaps = 4/54 (7%) Frame = +2 Query: 2 GGPLDSSYLFDAYLKEVRQYRSNK----PEKATRPSPLLVDLLAKERVGVHPGI 151 GGPLDSSYLFD YL V +Y++N+ P++ +RPSPLLVDLLAKERVGV P I Sbjct: 383 GGPLDSSYLFDIYLDSVLKYKNNQAGLYPQRDSRPSPLLVDLLAKERVGVQPTI 436 >dbj|GAD91931.1| carbamoyl-phosphate synthase, small subunit [Byssochlamys spectabilis No. 5] Length = 466 Score = 71.6 bits (174), Expect = 1e-10 Identities = 36/54 (66%), Positives = 44/54 (81%), Gaps = 4/54 (7%) Frame = +2 Query: 2 GGPLDSSYLFDAYLKEVRQYRSNK----PEKATRPSPLLVDLLAKERVGVHPGI 151 GGPLDSSYLFD YL+ V++YR+++ P + +RPSPLLVDLLAKERVGV P I Sbjct: 394 GGPLDSSYLFDIYLESVQKYRNSQAVFQPMRDSRPSPLLVDLLAKERVGVQPTI 447 >ref|XP_001274012.1| carbamoyl-phosphate synthase, small subunit [Aspergillus clavatus NRRL 1] gi|148886821|sp|A1CA18.1|CARA_ASPCL RecName: Full=Carbamoyl-phosphate synthase arginine-specific small chain; Short=CPS-A; AltName: Full=Arginine-specific carbamoyl-phosphate synthetase, glutamine chain gi|119402165|gb|EAW12586.1| carbamoyl-phosphate synthase, small subunit [Aspergillus clavatus NRRL 1] Length = 455 Score = 70.9 bits (172), Expect = 2e-10 Identities = 35/54 (64%), Positives = 43/54 (79%), Gaps = 4/54 (7%) Frame = +2 Query: 2 GGPLDSSYLFDAYLKEVRQYRSNK----PEKATRPSPLLVDLLAKERVGVHPGI 151 GGPLDSSYLFD Y+ VR+Y++N+ P++ + PSPLLVDLLAKERVGV P I Sbjct: 384 GGPLDSSYLFDIYIDSVRKYKANQAAFHPQRDSIPSPLLVDLLAKERVGVQPTI 437 >gb|EME84194.1| hypothetical protein MYCFIDRAFT_163024 [Pseudocercospora fijiensis CIRAD86] Length = 465 Score = 70.5 bits (171), Expect = 2e-10 Identities = 37/52 (71%), Positives = 40/52 (76%), Gaps = 4/52 (7%) Frame = +2 Query: 2 GGPLDSSYLFDAYLKEVRQYRSN----KPEKATRPSPLLVDLLAKERVGVHP 145 GGPLDSSYLFDAYL V+QY++ K K RPSPLLVDLLAKERVGV P Sbjct: 403 GGPLDSSYLFDAYLNSVQQYKAQNDVLKGGKDNRPSPLLVDLLAKERVGVAP 454 >ref|XP_003840918.1| similar to carbamoyl-phosphate synthase arginine-specific small chain [Leptosphaeria maculans JN3] gi|312217491|emb|CBX97439.1| similar to carbamoyl-phosphate synthase arginine-specific small chain [Leptosphaeria maculans JN3] Length = 506 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/57 (56%), Positives = 44/57 (77%), Gaps = 3/57 (5%) Frame = +2 Query: 2 GGPLDSSYLFDAYLKEVRQYRSNKP---EKATRPSPLLVDLLAKERVGVHPGIPDYQ 163 GGPLDS+YLFD Y+ V+QY+ ++ ++ +PSPLLVDLL+K RVGVHP PD++ Sbjct: 418 GGPLDSAYLFDKYMDNVQQYKEHQASFSDRNNKPSPLLVDLLSKVRVGVHPAQPDFE 474