BLASTX nr result
ID: Akebia25_contig00057045
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00057045 (291 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007035608.1| Condensin-2 complex subunit D3 isoform 1 [Th... 58 1e-06 ref|XP_006349818.1| PREDICTED: condensin-2 complex subunit D3-li... 56 5e-06 ref|XP_004253150.1| PREDICTED: condensin-2 complex subunit D3-li... 56 5e-06 >ref|XP_007035608.1| Condensin-2 complex subunit D3 isoform 1 [Theobroma cacao] gi|508714637|gb|EOY06534.1| Condensin-2 complex subunit D3 isoform 1 [Theobroma cacao] Length = 1713 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = -1 Query: 291 QLYLSILLSPNSPIFTLFTPIPFLSLLRSLCQSFK 187 ++YLS+LLSPNSP+FTLFTPI FLSLLRSL ++FK Sbjct: 450 KVYLSLLLSPNSPVFTLFTPISFLSLLRSLRRAFK 484 >ref|XP_006349818.1| PREDICTED: condensin-2 complex subunit D3-like [Solanum tuberosum] Length = 1337 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = -1 Query: 291 QLYLSILLSPNSPIFTLFTPIPFLSLLRSLCQSFK 187 ++YLS+LL+PNSP+FTLFTP+ FLSLLRS+ Q FK Sbjct: 90 KVYLSLLLTPNSPVFTLFTPMAFLSLLRSIRQGFK 124 >ref|XP_004253150.1| PREDICTED: condensin-2 complex subunit D3-like [Solanum lycopersicum] Length = 1336 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = -1 Query: 291 QLYLSILLSPNSPIFTLFTPIPFLSLLRSLCQSFK 187 ++YLS+LL+PNSP+FTLFTP+ FLSLLRS+ Q FK Sbjct: 89 KVYLSLLLTPNSPVFTLFTPMAFLSLLRSIRQGFK 123