BLASTX nr result
ID: Akebia25_contig00056974
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00056974 (552 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_008815228.1| ribosomal protein S12 (chloroplast) [Kalopan... 67 4e-09 ref|YP_008815183.1| ribosomal protein S12 (chloroplast) [Kalopan... 65 1e-08 ref|YP_008814967.1| ribosomal protein S12 (chloroplast) [Brassai... 65 1e-08 ref|YP_008814922.1| ribosomal protein S12 (chloroplast) [Brassai... 64 3e-08 ref|YP_008815054.1| ribosomal protein S12 (chloroplast) [Metapan... 63 4e-08 ref|YP_008815009.1| ribosomal protein S12 (chloroplast) [Metapan... 63 4e-08 gb|AGZ19166.1| ribosomal protein S12 (chloroplast) [Camellia sin... 59 1e-07 gb|ABX26257.1| ribosomal protein S12-like protein [Panax quinque... 58 2e-06 >ref|YP_008815228.1| ribosomal protein S12 (chloroplast) [Kalopanax septemlobus] gi|458599672|gb|AGG39364.1| ribosomal protein S12 (chloroplast) [Kalopanax septemlobus] Length = 142 Score = 66.6 bits (161), Expect = 4e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +3 Query: 162 GCPQRRGTCTRVYVRLVQIMSWDKRKETIFPVSMT 266 GCPQRRGTCTRVYVRLVQIMSWDKRK+T F +T Sbjct: 26 GCPQRRGTCTRVYVRLVQIMSWDKRKKTFFQYQIT 60 >ref|YP_008815183.1| ribosomal protein S12 (chloroplast) [Kalopanax septemlobus] gi|458599659|gb|AGG39351.1| ribosomal protein S12 (chloroplast) [Kalopanax septemlobus] Length = 143 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 162 GCPQRRGTCTRVYVRLVQIMSWDKRKETIF 251 GCPQRRGTCTRVYVRLVQIMSWDKRK+T F Sbjct: 26 GCPQRRGTCTRVYVRLVQIMSWDKRKKTFF 55 >ref|YP_008814967.1| ribosomal protein S12 (chloroplast) [Brassaiopsis hainla] gi|558603148|ref|YP_008815141.1| ribosomal protein S12 (chloroplast) [Schefflera delavayi] gi|563940339|ref|YP_008814880.1| ribosomal protein S12 (chloroplast) [Aralia undulata] gi|458599150|gb|AGG39016.1| ribosomal protein S12 (chloroplast) [Aralia undulata] gi|458599252|gb|AGG39103.1| ribosomal protein S12 (chloroplast) [Brassaiopsis hainla] gi|458599584|gb|AGG39277.1| ribosomal protein S12 (chloroplast) [Schefflera delavayi] Length = 149 Score = 65.1 bits (157), Expect = 1e-08 Identities = 35/53 (66%), Positives = 38/53 (71%) Frame = +3 Query: 162 GCPQRRGTCTRVYVRLVQIMSWDKRKETIFPVSMTSTYQ*NGRTPFTI*TKKP 320 GCPQRRGTCTRVYVRLVQIMSWDKRK+T S+ Y+ G TP KKP Sbjct: 26 GCPQRRGTCTRVYVRLVQIMSWDKRKKTF--SSINDPYRRIGITP-----KKP 71 >ref|YP_008814922.1| ribosomal protein S12 (chloroplast) [Brassaiopsis hainla] gi|558603135|ref|YP_008815096.1| ribosomal protein S12 (chloroplast) [Schefflera delavayi] gi|563940326|ref|YP_008814835.1| ribosomal protein S12 (chloroplast) [Aralia undulata] gi|458599137|gb|AGG39003.1| ribosomal protein S12 (chloroplast) [Aralia undulata] gi|458599239|gb|AGG39090.1| ribosomal protein S12 (chloroplast) [Brassaiopsis hainla] gi|458599571|gb|AGG39264.1| ribosomal protein S12 (chloroplast) [Schefflera delavayi] Length = 150 Score = 63.5 bits (153), Expect = 3e-08 Identities = 35/53 (66%), Positives = 38/53 (71%) Frame = +3 Query: 162 GCPQRRGTCTRVYVRLVQIMSWDKRKETIFPVSMTSTYQ*NGRTPFTI*TKKP 320 GCPQRRGTCTRVYVRLVQIMSWDKRK+T S+ Y+ G TI KKP Sbjct: 26 GCPQRRGTCTRVYVRLVQIMSWDKRKKTF--SSINDPYRRIG----TITPKKP 72 >ref|YP_008815054.1| ribosomal protein S12 (chloroplast) [Metapanax delavayi] gi|458599431|gb|AGG39190.1| ribosomal protein S12 (chloroplast) [Metapanax delavayi] Length = 161 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 162 GCPQRRGTCTRVYVRLVQIMSWDKRKETIFPVS 260 GCPQRRGTCTRVYVRLVQIMSWDKRK+T ++ Sbjct: 26 GCPQRRGTCTRVYVRLVQIMSWDKRKKTFSSIN 58 >ref|YP_008815009.1| ribosomal protein S12 (chloroplast) [Metapanax delavayi] gi|458599418|gb|AGG39177.1| ribosomal protein S12 (chloroplast) [Metapanax delavayi] Length = 165 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 162 GCPQRRGTCTRVYVRLVQIMSWDKRKETIFPVS 260 GCPQRRGTCTRVYVRLVQIMSWDKRK+T ++ Sbjct: 26 GCPQRRGTCTRVYVRLVQIMSWDKRKKTFSSIN 58 >gb|AGZ19166.1| ribosomal protein S12 (chloroplast) [Camellia sinensis] Length = 60 Score = 58.5 bits (140), Expect(2) = 1e-07 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +3 Query: 162 GCPQRRGTCTRVYVRLVQIMSWDKRKE 242 GCPQRRGTCTRVYVRLVQIM WDK KE Sbjct: 26 GCPQRRGTCTRVYVRLVQIMGWDKTKE 52 Score = 23.5 bits (49), Expect(2) = 1e-07 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +1 Query: 229 TKERRLFFQYQ 261 TKER+ FFQYQ Sbjct: 50 TKERKQFFQYQ 60 >gb|ABX26257.1| ribosomal protein S12-like protein [Panax quinquefolius] Length = 65 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +3 Query: 162 GCPQRRGTCTRVYVRLVQIMSWDKRKETIFPVS 260 GCPQRRGTCTR YV LVQIMSWDKRK+T ++ Sbjct: 26 GCPQRRGTCTRGYVGLVQIMSWDKRKKTFSSIN 58