BLASTX nr result
ID: Akebia25_contig00056920
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00056920 (320 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003852225.1| hypothetical protein MYCGRDRAFT_104550 [Zymo... 83 3e-14 gb|EMF13709.1| cyclin-domain-containing protein [Sphaerulina mus... 80 2e-13 gb|EMC93199.1| hypothetical protein BAUCODRAFT_76527 [Baudoinia ... 79 5e-13 gb|EME44231.1| hypothetical protein DOTSEDRAFT_71912 [Dothistrom... 79 6e-13 >ref|XP_003852225.1| hypothetical protein MYCGRDRAFT_104550 [Zymoseptoria tritici IPO323] gi|339472106|gb|EGP87201.1| hypothetical protein MYCGRDRAFT_104550 [Zymoseptoria tritici IPO323] Length = 307 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/63 (58%), Positives = 50/63 (79%) Frame = -1 Query: 320 KWTQEHTSKVGGIGLAQLLNLEVSLCFLLDFDLWVDEAKLCKRMFLLQQAAKLGTGIRGK 141 KW QE +KVGG+ QLLNLEV+LCFLLDF+L++DE + +RMF+LQ+AA+ G RG+ Sbjct: 231 KWAQERVAKVGGVSGQQLLNLEVTLCFLLDFELFIDEKIMARRMFMLQEAARQNVGARGR 290 Query: 140 LSD 132 LS+ Sbjct: 291 LSE 293 >gb|EMF13709.1| cyclin-domain-containing protein [Sphaerulina musiva SO2202] Length = 302 Score = 80.5 bits (197), Expect = 2e-13 Identities = 34/63 (53%), Positives = 51/63 (80%) Frame = -1 Query: 320 KWTQEHTSKVGGIGLAQLLNLEVSLCFLLDFDLWVDEAKLCKRMFLLQQAAKLGTGIRGK 141 KW+QE +++GGI QL+NLE+++CFLLDF+L++DE + +RMFLLQ AA+ G G++G Sbjct: 226 KWSQERVARMGGISTMQLMNLEIAMCFLLDFELYLDERIMARRMFLLQSAARKGFGVQGG 285 Query: 140 LSD 132 LS+ Sbjct: 286 LSE 288 >gb|EMC93199.1| hypothetical protein BAUCODRAFT_76527 [Baudoinia compniacensis UAMH 10762] Length = 185 Score = 79.3 bits (194), Expect = 5e-13 Identities = 39/62 (62%), Positives = 46/62 (74%) Frame = -1 Query: 320 KWTQEHTSKVGGIGLAQLLNLEVSLCFLLDFDLWVDEAKLCKRMFLLQQAAKLGTGIRGK 141 KWTQE +KVGG+ QL+NLEV+LCFLLDFDL VD A L +R FLLQQA + G G + Sbjct: 107 KWTQELYAKVGGVSRNQLMNLEVTLCFLLDFDLGVDAAVLARRTFLLQQAGRQGLGTNSR 166 Query: 140 LS 135 LS Sbjct: 167 LS 168 >gb|EME44231.1| hypothetical protein DOTSEDRAFT_71912 [Dothistroma septosporum NZE10] Length = 310 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/60 (63%), Positives = 47/60 (78%), Gaps = 4/60 (6%) Frame = -1 Query: 320 KWTQEHTSKVGGIGLAQLLNLEVSLCFLLDFDLWVDEAKLCKRMFLLQQAA----KLGTG 153 KW QE +KVGG+ QLLNLEV+LCFLLDF+L+VDE +C+RM+LLQQAA +LG G Sbjct: 232 KWAQERVAKVGGVSNVQLLNLEVTLCFLLDFELFVDEKIMCRRMYLLQQAAQTQHRLGVG 291