BLASTX nr result
ID: Akebia25_contig00056833
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00056833 (389 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMF08838.1| hypothetical protein SEPMUDRAFT_151753 [Sphaeruli... 57 3e-06 >gb|EMF08838.1| hypothetical protein SEPMUDRAFT_151753 [Sphaerulina musiva SO2202] Length = 852 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +1 Query: 1 REWDSGPTDIQVDGEVDTAHTVQSEGYELRLLY 99 REWD+GPTDIQ DGE+ TA VQS GYEL+LL+ Sbjct: 820 REWDAGPTDIQCDGELSTAENVQSHGYELKLLF 852