BLASTX nr result
ID: Akebia25_contig00056764
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00056764 (245 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG13638.1| Peptidase M13 neprilysin [Macrophomina phaseolina... 136 3e-30 ref|XP_007588650.1| putative endothelin-converting enzyme protei... 129 3e-28 ref|XP_007295637.1| peptidase family M13 [Marssonina brunnea f. ... 118 1e-24 gb|ETS84676.1| hypothetical protein PFICI_02701 [Pestalotiopsis ... 115 5e-24 gb|EMR88223.1| putative endothelin-converting enzyme protein [Bo... 114 1e-23 emb|CCD56207.1| similar to neprilysin [Botryotinia fuckeliana T4] 114 1e-23 ref|XP_001552037.1| hypothetical protein BC1G_09378 [Botryotinia... 114 1e-23 gb|EXJ92195.1| hypothetical protein A1O3_00745 [Capronia epimyce... 113 2e-23 gb|EPE29307.1| Metalloproteases (zincins), catalytic [Glarea loz... 113 3e-23 gb|EHL03301.1| putative endothelin-converting enzyme 1 [Glarea l... 113 3e-23 ref|XP_001592776.1| hypothetical protein SS1G_05697 [Sclerotinia... 113 3e-23 gb|EXJ93893.1| hypothetical protein A1O1_02286 [Capronia coronat... 112 4e-23 gb|ESZ98803.1| hypothetical protein SBOR_0802 [Sclerotinia borea... 112 4e-23 gb|EHY54424.1| endothelin-converting enzyme [Exophiala dermatiti... 111 9e-23 gb|EQB50363.1| peptidase family M13 [Colletotrichum gloeosporioi... 111 1e-22 gb|ENH82621.1| endothelin-converting enzyme [Colletotrichum orbi... 110 2e-22 ref|XP_007283366.1| endothelin-converting enzyme [Colletotrichum... 110 2e-22 gb|EUN24183.1| hypothetical protein COCVIDRAFT_106846 [Bipolaris... 110 2e-22 gb|EUC28009.1| hypothetical protein COCCADRAFT_110257 [Bipolaris... 110 2e-22 gb|ETN41603.1| hypothetical protein HMPREF1541_03539 [Cyphelloph... 110 2e-22 >gb|EKG13638.1| Peptidase M13 neprilysin [Macrophomina phaseolina MS6] Length = 779 Score = 136 bits (342), Expect = 3e-30 Identities = 58/81 (71%), Positives = 69/81 (85%) Frame = +2 Query: 2 EIVFPAGIMQLPVFSSKLPEYVSYGAFGAVAGHELTHGFDNHGSEYNEKGVYQPWWDNST 181 EI FPAGIM+ P F+ +LPEY+SYG+FG VAGHELTHGFDN GS+Y+E G Y WWDN+T Sbjct: 582 EIAFPAGIMKNPFFNLELPEYISYGSFGMVAGHELTHGFDNSGSQYDENGAYNQWWDNTT 641 Query: 182 RANFDQRSQCFVGQYSKYTVP 244 RANF+ R+QCFV QYSK+TVP Sbjct: 642 RANFENRTQCFVDQYSKFTVP 662 >ref|XP_007588650.1| putative endothelin-converting enzyme protein [Neofusicoccum parvum UCRNP2] gi|485916649|gb|EOD43897.1| putative endothelin-converting enzyme protein [Neofusicoccum parvum UCRNP2] Length = 783 Score = 129 bits (325), Expect = 3e-28 Identities = 54/81 (66%), Positives = 68/81 (83%) Frame = +2 Query: 2 EIVFPAGIMQLPVFSSKLPEYVSYGAFGAVAGHELTHGFDNHGSEYNEKGVYQPWWDNST 181 EI FPAGIM+ P F+ +PEY+SYG+FG VAGHELTHGFD+ GS+Y+E G + WWD++T Sbjct: 586 EIAFPAGIMKNPFFNRDVPEYISYGSFGVVAGHELTHGFDDSGSQYDENGAFNQWWDDTT 645 Query: 182 RANFDQRSQCFVGQYSKYTVP 244 RANF+ R+QCFV QYSK+TVP Sbjct: 646 RANFENRTQCFVDQYSKFTVP 666 >ref|XP_007295637.1| peptidase family M13 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406861015|gb|EKD14071.1| peptidase family M13 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 798 Score = 118 bits (295), Expect = 1e-24 Identities = 49/81 (60%), Positives = 63/81 (77%) Frame = +2 Query: 2 EIVFPAGIMQLPVFSSKLPEYVSYGAFGAVAGHELTHGFDNHGSEYNEKGVYQPWWDNST 181 EIVFPAGIMQ PVF + +P+YVSYGAFG+V+GHEL+H FD+ G Y++ G Y WW N+T Sbjct: 603 EIVFPAGIMQFPVFDASIPQYVSYGAFGSVSGHELSHAFDSTGRHYDQNGNYTDWWTNNT 662 Query: 182 RANFDQRSQCFVGQYSKYTVP 244 F+ R++CF+ QY KYTVP Sbjct: 663 VEGFETRAECFIDQYHKYTVP 683 >gb|ETS84676.1| hypothetical protein PFICI_02701 [Pestalotiopsis fici W106-1] Length = 784 Score = 115 bits (289), Expect = 5e-24 Identities = 51/80 (63%), Positives = 58/80 (72%) Frame = +2 Query: 2 EIVFPAGIMQLPVFSSKLPEYVSYGAFGAVAGHELTHGFDNHGSEYNEKGVYQPWWDNST 181 EIVFPA IMQ PVF KLP YVSYGAF AVAGHEL+H FDN G Y+E G Y WW N T Sbjct: 588 EIVFPAAIMQFPVFDEKLPSYVSYGAFAAVAGHELSHAFDNSGRHYDETGRYTDWWTNHT 647 Query: 182 RANFDQRSQCFVGQYSKYTV 241 F++R+ CFV QYS +T+ Sbjct: 648 VEEFEKRADCFVNQYSNFTI 667 >gb|EMR88223.1| putative endothelin-converting enzyme protein [Botryotinia fuckeliana BcDW1] Length = 826 Score = 114 bits (286), Expect = 1e-23 Identities = 49/81 (60%), Positives = 62/81 (76%) Frame = +2 Query: 2 EIVFPAGIMQLPVFSSKLPEYVSYGAFGAVAGHELTHGFDNHGSEYNEKGVYQPWWDNST 181 EIVFPAGIMQ PVF +P+Y+SYGAFGAV+GHEL+H FD+ G Y++ G Y WW ST Sbjct: 628 EIVFPAGIMQFPVFDVAVPQYLSYGAFGAVSGHELSHAFDSTGRHYDQNGNYTDWWTPST 687 Query: 182 RANFDQRSQCFVGQYSKYTVP 244 A F +R+QCF+ QYS Y++P Sbjct: 688 VAAFKERAQCFIDQYSNYSIP 708 >emb|CCD56207.1| similar to neprilysin [Botryotinia fuckeliana T4] Length = 918 Score = 114 bits (286), Expect = 1e-23 Identities = 49/81 (60%), Positives = 62/81 (76%) Frame = +2 Query: 2 EIVFPAGIMQLPVFSSKLPEYVSYGAFGAVAGHELTHGFDNHGSEYNEKGVYQPWWDNST 181 EIVFPAGIMQ PVF +P+Y+SYGAFGAV+GHEL+H FD+ G Y++ G Y WW ST Sbjct: 720 EIVFPAGIMQFPVFDVAVPQYLSYGAFGAVSGHELSHAFDSTGRHYDQNGNYTDWWTPST 779 Query: 182 RANFDQRSQCFVGQYSKYTVP 244 A F +R+QCF+ QYS Y++P Sbjct: 780 VAAFKERAQCFIDQYSNYSIP 800 >ref|XP_001552037.1| hypothetical protein BC1G_09378 [Botryotinia fuckeliana B05.10] Length = 990 Score = 114 bits (286), Expect = 1e-23 Identities = 49/81 (60%), Positives = 62/81 (76%) Frame = +2 Query: 2 EIVFPAGIMQLPVFSSKLPEYVSYGAFGAVAGHELTHGFDNHGSEYNEKGVYQPWWDNST 181 EIVFPAGIMQ PVF +P+Y+SYGAFGAV+GHEL+H FD+ G Y++ G Y WW ST Sbjct: 793 EIVFPAGIMQFPVFDVAVPQYLSYGAFGAVSGHELSHAFDSTGRHYDQNGNYTDWWTPST 852 Query: 182 RANFDQRSQCFVGQYSKYTVP 244 A F +R+QCF+ QYS Y++P Sbjct: 853 VAAFKERAQCFIDQYSNYSIP 873 >gb|EXJ92195.1| hypothetical protein A1O3_00745 [Capronia epimyces CBS 606.96] Length = 776 Score = 113 bits (283), Expect = 2e-23 Identities = 49/80 (61%), Positives = 61/80 (76%) Frame = +2 Query: 2 EIVFPAGIMQLPVFSSKLPEYVSYGAFGAVAGHELTHGFDNHGSEYNEKGVYQPWWDNST 181 EIVFPAGIMQ PVF +PEYVSYGAFG+V+GHEL+H FD+ G Y++ G + WW T Sbjct: 581 EIVFPAGIMQFPVFDVNVPEYVSYGAFGSVSGHELSHAFDSTGRHYDQNGNFTDWWTEKT 640 Query: 182 RANFDQRSQCFVGQYSKYTV 241 ANF +R++CFV QYS +TV Sbjct: 641 VANFKERAECFVQQYSNFTV 660 >gb|EPE29307.1| Metalloproteases (zincins), catalytic [Glarea lozoyensis ATCC 20868] Length = 818 Score = 113 bits (282), Expect = 3e-23 Identities = 48/81 (59%), Positives = 63/81 (77%) Frame = +2 Query: 2 EIVFPAGIMQLPVFSSKLPEYVSYGAFGAVAGHELTHGFDNHGSEYNEKGVYQPWWDNST 181 EIVFPAGIMQ PVF +P+Y+SYGAFG+V+GHEL+H FD+ G Y++ G Y WW NST Sbjct: 623 EIVFPAGIMQFPVFDVNVPQYLSYGAFGSVSGHELSHAFDSTGRHYDQNGNYTDWWTNST 682 Query: 182 RANFDQRSQCFVGQYSKYTVP 244 F +R++CFV QYS+++VP Sbjct: 683 VDAFKERAECFVDQYSQFSVP 703 >gb|EHL03301.1| putative endothelin-converting enzyme 1 [Glarea lozoyensis 74030] Length = 686 Score = 113 bits (282), Expect = 3e-23 Identities = 48/81 (59%), Positives = 63/81 (77%) Frame = +2 Query: 2 EIVFPAGIMQLPVFSSKLPEYVSYGAFGAVAGHELTHGFDNHGSEYNEKGVYQPWWDNST 181 EIVFPAGIMQ PVF +P+Y+SYGAFG+V+GHEL+H FD+ G Y++ G Y WW NST Sbjct: 494 EIVFPAGIMQFPVFDVNVPQYLSYGAFGSVSGHELSHAFDSTGRHYDQNGNYTDWWTNST 553 Query: 182 RANFDQRSQCFVGQYSKYTVP 244 F +R++CFV QYS+++VP Sbjct: 554 VDAFKERAECFVDQYSQFSVP 574 >ref|XP_001592776.1| hypothetical protein SS1G_05697 [Sclerotinia sclerotiorum 1980] gi|154703478|gb|EDO03217.1| hypothetical protein SS1G_05697 [Sclerotinia sclerotiorum 1980 UF-70] Length = 825 Score = 113 bits (282), Expect = 3e-23 Identities = 48/81 (59%), Positives = 61/81 (75%) Frame = +2 Query: 2 EIVFPAGIMQLPVFSSKLPEYVSYGAFGAVAGHELTHGFDNHGSEYNEKGVYQPWWDNST 181 EIVFPAGIMQ PVF +P+Y+SYGAFGAV+GHEL+H FD+ G Y++ G Y WW ST Sbjct: 627 EIVFPAGIMQFPVFDVAVPQYLSYGAFGAVSGHELSHAFDSTGRHYDQNGNYTDWWTPST 686 Query: 182 RANFDQRSQCFVGQYSKYTVP 244 A F +R+QCF+ QY Y++P Sbjct: 687 VAAFKERAQCFIDQYGNYSIP 707 >gb|EXJ93893.1| hypothetical protein A1O1_02286 [Capronia coronata CBS 617.96] Length = 772 Score = 112 bits (281), Expect = 4e-23 Identities = 47/80 (58%), Positives = 61/80 (76%) Frame = +2 Query: 2 EIVFPAGIMQLPVFSSKLPEYVSYGAFGAVAGHELTHGFDNHGSEYNEKGVYQPWWDNST 181 EIVFPAGIMQ PVF +P+YVSYGAFG+V+GHEL+H FD+ G Y++ G Y WW N T Sbjct: 577 EIVFPAGIMQFPVFDVNVPDYVSYGAFGSVSGHELSHAFDSTGRHYDQNGNYTDWWTNKT 636 Query: 182 RANFDQRSQCFVGQYSKYTV 241 +NF + ++CF+ QYS +TV Sbjct: 637 VSNFKEHAECFIEQYSNFTV 656 >gb|ESZ98803.1| hypothetical protein SBOR_0802 [Sclerotinia borealis F-4157] Length = 836 Score = 112 bits (281), Expect = 4e-23 Identities = 48/81 (59%), Positives = 61/81 (75%) Frame = +2 Query: 2 EIVFPAGIMQLPVFSSKLPEYVSYGAFGAVAGHELTHGFDNHGSEYNEKGVYQPWWDNST 181 EIVFPAGIMQ PVF +P+Y+SYGAFGAV+GHEL+H FD+ G Y++ G Y WW ST Sbjct: 638 EIVFPAGIMQFPVFDVAVPQYLSYGAFGAVSGHELSHAFDSTGRHYDQNGNYTDWWTPST 697 Query: 182 RANFDQRSQCFVGQYSKYTVP 244 A F +R+QCF+ QY Y++P Sbjct: 698 VAAFKERAQCFIEQYGNYSIP 718 >gb|EHY54424.1| endothelin-converting enzyme [Exophiala dermatitidis NIH/UT8656] Length = 776 Score = 111 bits (278), Expect = 9e-23 Identities = 47/80 (58%), Positives = 60/80 (75%) Frame = +2 Query: 2 EIVFPAGIMQLPVFSSKLPEYVSYGAFGAVAGHELTHGFDNHGSEYNEKGVYQPWWDNST 181 EIVFPAGIMQ PVF +P+Y+SYGAFG+V+GHEL+H FD+ G Y++ G Y WW N T Sbjct: 581 EIVFPAGIMQFPVFDVDVPQYISYGAFGSVSGHELSHAFDSTGRHYDQNGNYTDWWTNKT 640 Query: 182 RANFDQRSQCFVGQYSKYTV 241 F +R++CFV QYS +TV Sbjct: 641 VTEFKKRAECFVDQYSNFTV 660 >gb|EQB50363.1| peptidase family M13 [Colletotrichum gloeosporioides Cg-14] Length = 755 Score = 111 bits (277), Expect = 1e-22 Identities = 47/81 (58%), Positives = 61/81 (75%) Frame = +2 Query: 2 EIVFPAGIMQLPVFSSKLPEYVSYGAFGAVAGHELTHGFDNHGSEYNEKGVYQPWWDNST 181 EIVFPAGIMQ PVF ++P Y+SYGAFG+VAGHEL+H FD+ G Y++ G Y WW + T Sbjct: 560 EIVFPAGIMQFPVFDVEVPAYMSYGAFGSVAGHELSHAFDSTGRHYDQNGNYTDWWTDDT 619 Query: 182 RANFDQRSQCFVGQYSKYTVP 244 F +R++CF+ QYS +TVP Sbjct: 620 VKAFQERAECFIEQYSNFTVP 640 >gb|ENH82621.1| endothelin-converting enzyme [Colletotrichum orbiculare MAFF 240422] Length = 760 Score = 110 bits (276), Expect = 2e-22 Identities = 48/81 (59%), Positives = 61/81 (75%) Frame = +2 Query: 2 EIVFPAGIMQLPVFSSKLPEYVSYGAFGAVAGHELTHGFDNHGSEYNEKGVYQPWWDNST 181 EIVFPAGIMQ PVF ++P Y+SYGAFG+VAGHEL+H FD+ G Y++ G Y WW +T Sbjct: 565 EIVFPAGIMQFPVFDVEVPAYMSYGAFGSVAGHELSHAFDSTGRHYDQNGNYTDWWSEAT 624 Query: 182 RANFDQRSQCFVGQYSKYTVP 244 F +R++CFV QYS +TVP Sbjct: 625 VDAFKKRAECFVEQYSNFTVP 645 >ref|XP_007283366.1| endothelin-converting enzyme [Colletotrichum gloeosporioides Nara gc5] gi|429852452|gb|ELA27588.1| endothelin-converting enzyme [Colletotrichum gloeosporioides Nara gc5] Length = 751 Score = 110 bits (276), Expect = 2e-22 Identities = 47/81 (58%), Positives = 61/81 (75%) Frame = +2 Query: 2 EIVFPAGIMQLPVFSSKLPEYVSYGAFGAVAGHELTHGFDNHGSEYNEKGVYQPWWDNST 181 EIVFPAGIMQ PVF ++P Y+SYGAFG+VAGHEL+H FD+ G Y++ G Y WW + T Sbjct: 556 EIVFPAGIMQFPVFDVEVPAYMSYGAFGSVAGHELSHAFDSTGRHYDQNGNYTDWWTDDT 615 Query: 182 RANFDQRSQCFVGQYSKYTVP 244 F +R++CF+ QYS +TVP Sbjct: 616 VKAFQERAKCFIEQYSNFTVP 636 >gb|EUN24183.1| hypothetical protein COCVIDRAFT_106846 [Bipolaris victoriae FI3] Length = 752 Score = 110 bits (275), Expect = 2e-22 Identities = 48/81 (59%), Positives = 61/81 (75%) Frame = +2 Query: 2 EIVFPAGIMQLPVFSSKLPEYVSYGAFGAVAGHELTHGFDNHGSEYNEKGVYQPWWDNST 181 EIVFPAGIMQ PVF ++PEY+SYGAFG+VAGHEL+H FD+ G Y++ G WW ST Sbjct: 557 EIVFPAGIMQFPVFDVEIPEYMSYGAFGSVAGHELSHAFDSTGRHYDQNGNLTDWWSKST 616 Query: 182 RANFDQRSQCFVGQYSKYTVP 244 F ++++CFV QYS +TVP Sbjct: 617 IDAFTKKTECFVEQYSNFTVP 637 >gb|EUC28009.1| hypothetical protein COCCADRAFT_110257 [Bipolaris zeicola 26-R-13] Length = 752 Score = 110 bits (275), Expect = 2e-22 Identities = 48/81 (59%), Positives = 61/81 (75%) Frame = +2 Query: 2 EIVFPAGIMQLPVFSSKLPEYVSYGAFGAVAGHELTHGFDNHGSEYNEKGVYQPWWDNST 181 EIVFPAGIMQ PVF ++PEY+SYGAFG+VAGHEL+H FD+ G Y++ G WW ST Sbjct: 557 EIVFPAGIMQFPVFDVEIPEYMSYGAFGSVAGHELSHAFDSTGRHYDQNGNLTDWWSKST 616 Query: 182 RANFDQRSQCFVGQYSKYTVP 244 F ++++CFV QYS +TVP Sbjct: 617 IDAFTKKTECFVEQYSNFTVP 637 >gb|ETN41603.1| hypothetical protein HMPREF1541_03539 [Cyphellophora europaea CBS 101466] Length = 762 Score = 110 bits (275), Expect = 2e-22 Identities = 46/80 (57%), Positives = 60/80 (75%) Frame = +2 Query: 2 EIVFPAGIMQLPVFSSKLPEYVSYGAFGAVAGHELTHGFDNHGSEYNEKGVYQPWWDNST 181 EIVFPAGIMQ PVF +++PEY+SYGAFG+V+GHEL+H FD+ G Y++ G Y WW +T Sbjct: 567 EIVFPAGIMQFPVFDAEVPEYLSYGAFGSVSGHELSHAFDSTGRHYDQNGNYTDWWTENT 626 Query: 182 RANFDQRSQCFVGQYSKYTV 241 F +R+ CFV QY YT+ Sbjct: 627 VKEFSKRADCFVEQYGNYTI 646