BLASTX nr result
ID: Akebia25_contig00056718
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00056718 (271 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006383815.1| hypothetical protein POPTR_0004s00200g, part... 61 1e-07 ref|XP_006371688.1| hypothetical protein POPTR_0019s15440g, part... 59 5e-07 ref|XP_006370799.1| hypothetical protein POPTR_0001s47740g, part... 59 7e-07 ref|XP_006379378.1| hypothetical protein POPTR_0008s00200g [Popu... 59 9e-07 ref|XP_006380539.1| hypothetical protein POPTR_0007s08675g [Popu... 56 1e-06 ref|XP_006389240.1| hypothetical protein POPTR_0032s00200g, part... 54 2e-06 ref|XP_006379379.1| hypothetical protein POPTR_0008s00250g, part... 56 5e-06 ref|XP_006374724.1| hypothetical protein POPTR_0014s00220g, part... 56 6e-06 ref|XP_006378919.1| hypothetical protein POPTR_0009s00560g [Popu... 54 8e-06 >ref|XP_006383815.1| hypothetical protein POPTR_0004s00200g, partial [Populus trichocarpa] gi|550339960|gb|ERP61612.1| hypothetical protein POPTR_0004s00200g, partial [Populus trichocarpa] Length = 389 Score = 61.2 bits (147), Expect(2) = 1e-07 Identities = 28/75 (37%), Positives = 43/75 (57%) Frame = +2 Query: 2 GALDVCSDDNRLLFFKFGEEDELLEILDKGP*FVGGKLTVLKRWNLLVEMEKREEASIP* 181 G DV S N F+F EDEL ++++ GP GGK +L++W+ + + +P Sbjct: 65 GLEDVTSLANGFTMFRFKTEDELQKVIENGPWMFGGKAIILQKWHSGFVFDMNKNTKLPV 124 Query: 182 WIKLYNLPKHLWTLK 226 WI++Y+LP LWT K Sbjct: 125 WIQIYDLPFPLWTKK 139 Score = 20.4 bits (41), Expect(2) = 1e-07 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 Query: 225 RGLGYVASGVGKPL 266 +GL VAS VG+PL Sbjct: 139 KGLSEVASMVGQPL 152 >ref|XP_006371688.1| hypothetical protein POPTR_0019s15440g, partial [Populus trichocarpa] gi|550317630|gb|ERP49485.1| hypothetical protein POPTR_0019s15440g, partial [Populus trichocarpa] Length = 275 Score = 58.5 bits (140), Expect(2) = 5e-07 Identities = 27/73 (36%), Positives = 42/73 (57%) Frame = +2 Query: 2 GALDVCSDDNRLLFFKFGEEDELLEILDKGP*FVGGKLTVLKRWNLLVEMEKREEASIP* 181 G DV S N F+F EDEL ++++ GP GGK +L++W+ + + +P Sbjct: 16 GLEDVTSLANGFTMFRFKTEDELQKVIENGPWMFGGKAIILQKWHSGFVFDMNKITKLPV 75 Query: 182 WIKLYNLPKHLWT 220 WI++Y+LP LWT Sbjct: 76 WIQIYDLPFLLWT 88 Score = 20.8 bits (42), Expect(2) = 5e-07 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 Query: 228 GLGYVASGVGKPLY 269 GL VAS VG+PL+ Sbjct: 91 GLSEVASMVGQPLF 104 >ref|XP_006370799.1| hypothetical protein POPTR_0001s47740g, partial [Populus trichocarpa] gi|550350108|gb|ERP67368.1| hypothetical protein POPTR_0001s47740g, partial [Populus trichocarpa] Length = 460 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/73 (36%), Positives = 42/73 (57%) Frame = +2 Query: 2 GALDVCSDDNRLLFFKFGEEDELLEILDKGP*FVGGKLTVLKRWNLLVEMEKREEASIP* 181 G DV S N F+F ED+L ++++ GP GGK +L++W+ + + IP Sbjct: 249 GLEDVTSLANGFTMFRFKTEDDLQKVIENGPWMFGGKAIILQKWHYGFVFDMNKITKIPV 308 Query: 182 WIKLYNLPKHLWT 220 WI++Y+LP LWT Sbjct: 309 WIQIYDLPFPLWT 321 >ref|XP_006379378.1| hypothetical protein POPTR_0008s00200g [Populus trichocarpa] gi|550332051|gb|ERP57175.1| hypothetical protein POPTR_0008s00200g [Populus trichocarpa] Length = 480 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/70 (35%), Positives = 42/70 (60%) Frame = +2 Query: 11 DVCSDDNRLLFFKFGEEDELLEILDKGP*FVGGKLTVLKRWNLLVEMEKREEASIP*WIK 190 DV S N + F+F ED+L ++++ GP GGK +L++W+ + + +P WI+ Sbjct: 126 DVTSLANGFIMFRFKTEDDLQKVIENGPWMFGGKAIILQKWHSGFVFDMNKITKLPVWIR 185 Query: 191 LYNLPKHLWT 220 +Y+LP LWT Sbjct: 186 IYDLPFPLWT 195 >ref|XP_006380539.1| hypothetical protein POPTR_0007s08675g [Populus trichocarpa] gi|550334426|gb|ERP58336.1| hypothetical protein POPTR_0007s08675g [Populus trichocarpa] Length = 500 Score = 56.2 bits (134), Expect(2) = 1e-06 Identities = 28/81 (34%), Positives = 42/81 (51%) Frame = +2 Query: 2 GALDVCSDDNRLLFFKFGEEDELLEILDKGP*FVGGKLTVLKRWNLLVEMEKREEASIP* 181 G +V S DN F F D +L++ + + VLKRW ++ K + A IP Sbjct: 160 GLSEVLSSDNGFFLFTFDSVDHATNVLERALWHMANRPLVLKRWQPNMQFLKDDLARIPV 219 Query: 182 WIKLYNLPKHLWTLKRIGVCC 244 W++LYN+P WT+K G+ C Sbjct: 220 WVRLYNVPLEYWTIK--GLSC 238 Score = 21.6 bits (44), Expect(2) = 1e-06 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +3 Query: 222 LRGLGYVASGVGKPLY 269 ++GL VAS +G PL+ Sbjct: 233 IKGLSCVASAIGVPLH 248 >ref|XP_006389240.1| hypothetical protein POPTR_0032s00200g, partial [Populus trichocarpa] gi|550311983|gb|ERP48154.1| hypothetical protein POPTR_0032s00200g, partial [Populus trichocarpa] Length = 183 Score = 53.5 bits (127), Expect(2) = 2e-06 Identities = 27/75 (36%), Positives = 39/75 (52%) Frame = +2 Query: 2 GALDVCSDDNRLLFFKFGEEDELLEILDKGP*FVGGKLTVLKRWNLLVEMEKREEASIP* 181 G L+V S DN F F + ILD P + + VL+RW ++ K + + IP Sbjct: 4 GLLEVLSSDNGFFLFLFDLVEHASAILDHAPWHIANRHMVLRRWRSNMQFSKVKLSRIPV 63 Query: 182 WIKLYNLPKHLWTLK 226 WIKL+++P WT K Sbjct: 64 WIKLHHVPLEYWTNK 78 Score = 23.5 bits (49), Expect(2) = 2e-06 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +3 Query: 225 RGLGYVASGVGKPLY 269 +GL YVAS +G PL+ Sbjct: 78 KGLSYVASALGVPLH 92 >ref|XP_006379379.1| hypothetical protein POPTR_0008s00250g, partial [Populus trichocarpa] gi|550332052|gb|ERP57176.1| hypothetical protein POPTR_0008s00250g, partial [Populus trichocarpa] Length = 390 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/72 (36%), Positives = 41/72 (56%) Frame = +2 Query: 2 GALDVCSDDNRLLFFKFGEEDELLEILDKGP*FVGGKLTVLKRWNLLVEMEKREEASIP* 181 G DV S N F+F EDEL ++++ GP GGK +L++W+ + + +P Sbjct: 115 GLEDVTSLANGFTMFRFKIEDELQKVIENGPWMFGGKAIILQKWHSGFVFDMNKITKLPV 174 Query: 182 WIKLYNLPKHLW 217 WI++Y+LP LW Sbjct: 175 WIQIYDLPFPLW 186 >ref|XP_006374724.1| hypothetical protein POPTR_0014s00220g, partial [Populus trichocarpa] gi|550322980|gb|ERP52521.1| hypothetical protein POPTR_0014s00220g, partial [Populus trichocarpa] Length = 320 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/79 (30%), Positives = 46/79 (58%) Frame = +2 Query: 2 GALDVCSDDNRLLFFKFGEEDELLEILDKGP*FVGGKLTVLKRWNLLVEMEKREEASIP* 181 G +V + N + F+F E+ +L+KGP GGK VL++W+ + +K +++P Sbjct: 79 GLENVSTTSNGFMIFQFTTAAEMHTVLEKGPWMFGGKNIVLQQWHPRFQFDKNNISTLPI 138 Query: 182 WIKLYNLPKHLWTLKRIGV 238 W++L++ P LW+ R+ + Sbjct: 139 WVRLHDFPFPLWSKSRLSM 157 >ref|XP_006378919.1| hypothetical protein POPTR_0009s00560g [Populus trichocarpa] gi|550330742|gb|ERP56716.1| hypothetical protein POPTR_0009s00560g [Populus trichocarpa] Length = 472 Score = 53.5 bits (127), Expect(2) = 8e-06 Identities = 27/81 (33%), Positives = 41/81 (50%) Frame = +2 Query: 2 GALDVCSDDNRLLFFKFGEEDELLEILDKGP*FVGGKLTVLKRWNLLVEMEKREEASIP* 181 G +V S DN F F D +L++ P + + VLK W ++ K + A I Sbjct: 142 GLSEVLSSDNGFFLFTFDSVDHATNMLERAPWHMANRPLVLKHWQPNMQFLKDDLARILV 201 Query: 182 WIKLYNLPKHLWTLKRIGVCC 244 W++LYN+P WT+K G+ C Sbjct: 202 WVRLYNVPLEYWTIK--GLSC 220 Score = 21.6 bits (44), Expect(2) = 8e-06 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +3 Query: 222 LRGLGYVASGVGKPLY 269 ++GL VAS +G PL+ Sbjct: 215 IKGLSCVASAIGVPLH 230