BLASTX nr result
ID: Akebia25_contig00056607
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00056607 (314 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB55739.1| Calmodulin-binding transcription activator 5 [Mor... 56 2e-06 >gb|EXB55739.1| Calmodulin-binding transcription activator 5 [Morus notabilis] Length = 1036 Score = 55.8 bits (133), Expect(2) = 2e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = -3 Query: 129 KLEENFNRMTVRLTILYGVECWVIKK*YVCGIMTVEEMRM*RW 1 KL+E F R+ +R T+LYG ECWVIK+ Y+C M+V EMRM RW Sbjct: 304 KLKEKFYRIVIRPTMLYGSECWVIKRQYICK-MSVTEMRMLRW 345 Score = 21.2 bits (43), Expect(2) = 2e-06 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -1 Query: 227 GNL*GDVAHVIVVRWLR*KCDSRVRCDPWIPIK 129 G++ DV H I ++ K + V CD +PIK Sbjct: 272 GDIEEDVQHGIKAGMVKWKNATGVLCDGKMPIK 304